Rv2645 Still unknown · low

H37Rv Rv2645 · MTBC0 mtbc0_002820 · 143 aa · 2993684–2994115 (+) · RefSeq NP_217161.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Immunodominant T-cell antigen encoded in region-of-difference RD13 (present in M. tuberculosis, absent from BCG and M. bovis); a cell-mediated-immunity-based diagnostic/vaccine antigen. Despite this immunological characterisation, its molecular/biochemical function remains unknown (verdict kept 'dark').

Curated reference (UniProt)

UniProt P9WL51 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2645

UniProt still lists this protein as Uncharacterized protein Rv2645; the revised annotation above is ahead of the current UniProt record.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.353 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2646 (integrase), high confidence from genomic context alone (score 953 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2646 integrase 952 953 ctx neighborhood:774 coexpression:799
Rv2647 hyp hypothetical protein 553 553 ctx neighborhood:529
Rv2661c hyp hypothetical protein 871 55 textmining:870
Rv1573 phage protein 630 55 textmining:625
Rv3469c mhpE 4-hydroxy-2-oxovalerate aldolase MhpE 804 47 textmining:803
Rv2738c hyp hypothetical protein 810 46 textmining:810
Rv0310c hyp hypothetical protein 808 46 textmining:807
Rv2290 lppO lipoprotein LppO 652 46 textmining:651
Rv1255c HTH-type transcriptional regulator 803 45 textmining:803
Rv2650c prophage protein 816 44 textmining:816
Rv2659c prophage integrase 660 44 textmining:659
Rv3221c TB7.3 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit 654 44 textmining:653
Rv2291 sseB thiosulfate sulfurtransferase SseB 631 44 textmining:630
Rv3470c ilvB2 acetolactate synthase large subunit 660 42 textmining:660
Rv3669 transmembrane protein 816 41 textmining:816

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • RD13 immunodominant T-cell antigen; M.tb-specific; CMI diagnostic agent (Luo 2015, PMID 26318635)
  • BCG::Rv2645 enhances protective immunity (Luo 2018, PMID 29681409)
  • Molecular function unknown - documented antigen context only
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217161.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt P9WL51 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor Rv2646
  • Primary literature: Luo W, Qu ZL, Xie Y, Xiang J, Zhang XL (2015). Identification of a novel immunodominant antigen Rv2645 from RD13 with potential as a cell-mediated immunity-based TB diagnostic agent J Infect 71(5):534-43. doi:10.1016/j.jinf.2015.07.011 PMID:26318635
  • Primary literature: Luo W, Qu Z, Zhang L, Xie Y, Luo F, Tan Y, Pan Q, Zhang XL (2018). Recombinant BCG::Rv2645 elicits enhanced protective immunity compared to BCG in vivo with induced ISGylation-related genes and Th1 and Th17 responses Vaccine 36(21):2998-3009. doi:10.1016/j.vaccine.2018.04.025 PMID:29681409

Ancestral MTBC0 protein sequence

>mtbc0_002820|Rv2645|
MTTTPRQPLFCAHADTNGDPGRCACGQQLADVGPATPPPPWCEPGTEPIWEQLTERYGGVTICQWTRYFPAGDPVAADVWIAADDRVVDGRVLRTQPAIHYTEPPVLGIGPAAARRLAAELLNAADTLDDGRRQLDDLGEHRR