Rv2749 Family assigned · medium auto-curated

H37Rv Rv2749 · MTBC0 mtbc0_002926 · 104 aa · 3084920–3085234 (+) · RefSeq NP_217265.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationputative quinol monooxygenase
Revised (this work)Putative quinol monooxygenase. Pfam: ABM (PF03992.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O33291 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionAntibiotic biosynthesis monooxygenase
Orthologous groupCOG1359

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.64% of strains (926) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ABMPF03992.23 1.3e-162–72 Antibiotic biosynthesis monooxygenase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2750 (dehydrogenase), high confidence from genomic context alone (score 888 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2750 dehydrogenase 888 888 ctx neighborhood:882
Rv2751 hyp hypothetical protein 884 884 ctx neighborhood:882
Rv2748c ftsK DNA translocase FtsK 599 599 ctx neighborhood:587
Rv1222 rseA anti-sigma E factor RseA 497 498 ctx cooccurence:496
Rv0793 monooxygenase 435 436 ctx cooccurence:434
Rv1629 polA DNA polymerase I 417 417 coexpression:417
Rv0759c hyp hypothetical protein 813 78 textmining:806
Rv3772 hisC2 histidinol-phosphate aminotransferase 874 72 textmining:870
Rv1435c hyp hypothetical protein 874 71 textmining:870
Rv0059 darT hyp hypothetical protein 658 59 textmining:652
Rv3345c PE_PGRS50 PE-PGRS family protein PE_PGRS50 657 56 textmining:652
Rv1726 oxidoreductase 871 54 textmining:870
Rv0917 betP glycine betaine transport integral membrane protein BetP 871 49 textmining:870
Rv0221 diacyglycerol O-acyltransferase 681 49 textmining:679
Rv1731 gabD2 succinate-semialdehyde dehydrogenase 662 47 textmining:660

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: putative quinol monooxygenase
  • Pfam (hmmscan --cut_ga): ABM PF03992.23 (E=1e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217265.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ABM (PF03992.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1359
  • Curated reference: UniProt O33291 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor Rv2750
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002926|Rv2749|
MPVVVVATLTAKPESVDTVRDILTRAVDDVHREPGCQLYALHETGETFIFVEQWADAEALKAHSGAPAVATMFTAAGEHLVGAPDIKLLQPVPAGDPSKGQLRR