recX Resolved · high auto-curated
H37Rv Rv2736c · MTBC0 mtbc0_002910 ·
174 aa ·
3070977–3071501 MTBC0
(-) ·
RefSeq NP_217252.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | regulatory protein RecX |
|---|---|
| MTBC0 PGAP re-annotation | recombination regulator RecX |
| Revised (this work) | Recombination regulator RecX. Pfam: RecX_HTH1 (PF21982.3), RecX_HTH2 (PF02631.23). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 11 publications
11 TB publications mention this gene. 11 publication(s) discuss this gene (9 in a M. tuberculosis context, 7 in other mycobacteria — M. smegmatis (7)).
| Publication | Date |
|---|---|
| Programmable Base Editing in Mycobacterium tuberculosis Using an Engineered CRISPR RNA-Guided Cytidine Deaminase. doi:10.3389/fgeed.2021.734436 | 2021 |
| The extended N-terminus of Mycobacterium smegmatis RecX potentiates its ability to antagonize RecA functions. doi:10.1016/j.bbapap.2020.140468 | 2020 |
| Elucidating the functional role of Mycobacterium smegmatis recX in stress response. doi:10.1038/s41598-019-47312-3 | 2019 |
| Mechanical force antagonizes the inhibitory effects of RecX on RecA filament formation in Mycobacterium tuberculosis. doi:10.1093/nar/gku899 | 2014 |
| Kinetics of recA and recX induction in drug-susceptible and MDR clinical strains of Mycobacterium tuberculosis. doi:10.1093/jac/dku319 | 2014 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 7 % of gene
| Neighbour | recA (Rv2737c, - strand) |
|---|---|
| Overlap | 35 bp, 7 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
WhiB4 (whiB4).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index -0.81 (95% CI -3.00 to 1.51). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | May play a regulatory role possibly by interacting with RECA, the product of the upstream ORF. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2755c
· 100.0% identity |
|---|---|
| M. leprae |
ML0988
· 77.0% identity |
| M. marinum |
MMAR_1978
· 82.4% identity |
| M. smegmatis |
MSMEG_2724
· 66.5% identity |
| M. orygis |
RJtmp_002820
· 99.4% identity |
| M. abscessus |
MAB_3059c
· 51.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHI1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Regulatory protein RecX |
| Curated function | Binds to RecA inhibiting ATP hydrolysis and the generation of heteroduplex DNA. It might act as an anti-recombinase to quell inappropriate recombinational repair during normal DNA metabolism. It is essential for cell survival. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | recX |
| eggNOG description | regulatory protein RecX |
| Orthologous group | COG2137 |
| KEGG orthology |
K03565
|
| Gene Ontology (6) |
GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.13 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
0.377 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 78.9%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 10/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 43.7% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 7 in the ORF — 0 in the essential state, 0 growth-defect, 7 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 32.5714285714. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 7 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 7 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 4 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1.21 ppm · rank 3247/3519 (7.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 174 aa |
|---|---|
| Molecular weight | 19.1 kDa |
| Theoretical pI | 9.49 |
| GRAVY | -0.399 (hydrophilic) |
| Aliphatic index | 94.3 |
| Aromaticity | 0.023 |
| Instability index | 52.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
RecX_HTH1 | PF21982.3 | 1.8e-12 | 17–56 | RecX, first three-helix domain |
RecX_HTH2 | PF02631.23 | 2.8e-12 | 63–104 | RecX, second three-helix domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3d5l-assembly1_A |
1.00 | 0.77 | 9.9e-07 sig | 3d5l-assembly1_A Crystal structure of regulatory protein RecX |
3d5l-assembly2_B |
1.00 | 0.83 | 5.0e-06 sig | 3d5l-assembly2_B Crystal structure of regulatory protein RecX |
3e3v-assembly1_A |
1.00 | 0.82 | 5.5e-06 sig | 3e3v-assembly1_A Crystal structure of RecX from Lactobacillus salivarius |
3dfg-assembly1_A |
1.00 | 0.73 | 4.8e-05 sig | 3dfg-assembly1_A Crystal Structure of RecX: A Potent Inhibitor Protein of RecA from Xanthomonas campestris |
3c1d-assembly3_A |
1.00 | 0.79 | 3.7e-03 sig | 3c1d-assembly3_A X-ray crystal structure of RecX |
Foldseek search of the AlphaFold DB model (mean pLDDT 91.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv2735c (- strand, 9 bp gap) |
|---|---|
| Downstream (3' on genome) | recA (- strand, -35 bp gap) |
| Predicted operon |
Rv2735c · recX · recA
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: recA (recombinase A), high confidence from genomic context alone (score 998 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2737c recA |
recombinase A | 999 | 998 ctx | neighborhood:881 coexpression:984 textmining:865 |
Rv3585 radA |
DNA repair protein RadA | 990 | 968 | coexpression:957 textmining:711 |
Rv2735c hyp |
hypothetical protein | 960 | 889 ctx | neighborhood:882 textmining:655 |
Rv2594c ruvC |
crossover junction endodeoxyribonuclease RuvC | 859 | 674 | coexpression:663 textmining:588 |
Rv2737A |
Rv2737A, len: 57 aa. Conserved hypothetical cys-rich protein (possibly gene fragment), similar to central part of AJ243803_1|glgA from Strep | 561 | 560 ctx | neighborhood:558 |
Rv2977c thiL |
thiamine-monophosphate kinase | 559 | 560 | coexpression:524 |
Rv2738c hyp |
hypothetical protein | 546 | 546 ctx | neighborhood:544 |
Rv2739c |
transferase | 536 | 537 ctx | neighborhood:532 |
Rv1696 recN |
DNA repair protein RecN | 714 | 431 | coexpression:413 textmining:518 |
Rv2921c ftsY |
signal recognition particle receptor FtsY | 419 | 420 | coexpression:408 |
Rv2593c ruvA |
Holliday junction ATP-dependent DNA helicase RuvA | 701 | 418 | textmining:509 |
Rv1460 sufR |
transcriptional regulator | 418 | 418 ctx | cooccurence:413 |
Rv2362c recO |
DNA repair protein RecO | 700 | 394 | textmining:526 |
Rv1901 cinA |
competence damage-inducible protein CinA | 687 | 390 | textmining:508 |
Rv2720 lexA |
repressor LexA | 668 | 338 | textmining:520 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: regulatory protein RecX
- MTBC0 PGAP product: recombination regulator RecX
- Pfam (hmmscan --cut_ga): RecX_HTH1 PF21982.3 (E=2e-12), RecX_HTH2 PF02631.23 (E=3e-12)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217252.1)
- Domains: Pfam-A via hmmscan --cut_ga — RecX_HTH1 (PF21982.3), RecX_HTH2 (PF02631.23)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2137 - Curated reference: UniProt P9WHI1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
44 functional partner(s); context anchor
recA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002910|Rv2736c|recX MTVSCPPPSTSEREEQARALCLRLLTARSRTRAELAGQLAKRGYPEDIGNRVLDRLAAVGLVDDTDFAEQWVQSRRANAAKSKRALAAELHAKGVDDDVITTVLGGIDAGAERGRAEKLVRARLRREVLIDDGTDEARVSRRLVAMLARRGYGQTLACEVVIAELAAERERRRV
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for recX? Email the maintainer — the message is pre-filled with this gene's details.