recX Resolved · high auto-curated

H37Rv Rv2736c · MTBC0 mtbc0_002910 · 174 aa · 3070977–3071501 (-) · RefSeq NP_217252.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)regulatory protein RecX
MTBC0 PGAP re-annotationrecombination regulator RecX
Revised (this work)Recombination regulator RecX. Pfam: RecX_HTH1 (PF21982.3), RecX_HTH2 (PF02631.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHI1 SwissProt · reviewed · Evidence at protein level
UniProt nameRegulatory protein RecX
Curated functionBinds to RecA inhibiting ATP hydrolysis and the generation of heteroduplex DNA. It might act as an anti-recombinase to quell inappropriate recombinational repair during normal DNA metabolism. It is essential for cell survival.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namerecX
eggNOG descriptionregulatory protein RecX
Orthologous groupCOG2137
KEGG orthology K03565
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.13 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RecX_HTH1PF21982.3 1.8e-1217–56 RecX, first three-helix domain
RecX_HTH2PF02631.23 2.8e-1263–104 RecX, second three-helix domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: recA (recombinase A), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2737c recA recombinase A 999 998 ctx neighborhood:881 coexpression:984 textmining:865
Rv3585 radA DNA repair protein RadA 990 968 coexpression:957 textmining:711
Rv2735c hyp hypothetical protein 960 889 ctx neighborhood:882 textmining:655
Rv2594c ruvC crossover junction endodeoxyribonuclease RuvC 859 674 coexpression:663 textmining:588
Rv2737A Rv2737A, len: 57 aa. Conserved hypothetical cys-rich protein (possibly gene fragment), similar to central part of AJ243803_1|glgA from Strep 561 560 ctx neighborhood:558
Rv2977c thiL thiamine-monophosphate kinase 559 560 coexpression:524
Rv2738c hyp hypothetical protein 546 546 ctx neighborhood:544
Rv2739c transferase 536 537 ctx neighborhood:532
Rv1696 recN DNA repair protein RecN 714 431 coexpression:413 textmining:518
Rv2921c ftsY signal recognition particle receptor FtsY 419 420 coexpression:408
Rv2593c ruvA Holliday junction ATP-dependent DNA helicase RuvA 701 418 textmining:509
Rv1460 sufR transcriptional regulator 418 418 ctx cooccurence:413
Rv2362c recO DNA repair protein RecO 700 394 textmining:526
Rv1901 cinA competence damage-inducible protein CinA 687 390 textmining:508
Rv2720 lexA repressor LexA 668 338 textmining:520

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: regulatory protein RecX
  • MTBC0 PGAP product: recombination regulator RecX
  • Pfam (hmmscan --cut_ga): RecX_HTH1 PF21982.3 (E=2e-12), RecX_HTH2 PF02631.23 (E=3e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217252.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RecX_HTH1 (PF21982.3), RecX_HTH2 (PF02631.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2137
  • Curated reference: UniProt P9WHI1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 44 functional partner(s); context anchor recA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002910|Rv2736c|recX
MTVSCPPPSTSEREEQARALCLRLLTARSRTRAELAGQLAKRGYPEDIGNRVLDRLAAVGLVDDTDFAEQWVQSRRANAAKSKRALAAELHAKGVDDDVITTVLGGIDAGAERGRAEKLVRARLRREVLIDDGTDEARVSRRLVAMLARRGYGQTLACEVVIAELAAERERRRV