mutT4 Resolved · high auto-curated

H37Rv Rv3908 · MTBC0 mtbc0_004142 · 248 aa · 4417701–4418447 (+) · RefSeq NP_218425.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)mutator protein MutT
MTBC0 PGAP re-annotationNUDIX hydrolase
Revised (this work)NUDIX hydrolase. Pfam: NUDIX (PF00293.35).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIX7 SwissProt · reviewed · Evidence at protein level
UniProt namePutative mutator protein MutT4
EC (curated) EC 3.6.1.-
Curated functionMay be involved in the GO system responsible for removing an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine, 8-oxo-dGTP) from DNA and the nucleotide pool (By similarity). In vitro has dATPase rather than 8-oxo-dGTPase activity.

UniProt still lists this protein as Putative mutator protein MutT4; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namemutT4
eggNOG descriptionBelongs to the NUDIX hydrolase family
Orthologous groupCOG0494

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.377 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NUDIXPF00293.35 2.8e-2088–188 NUDIX domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: murJ (peptidoglycan biosynthesis protein), high confidence from genomic context alone (score 884 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3909 hyp hypothetical protein 939 888 ctx neighborhood:881 textmining:478
Rv3910 murJ peptidoglycan biosynthesis protein 884 884 ctx neighborhood:881
Rv3912 rsmA anti-sigma-M factor RsmA 812 805 ctx neighborhood:804
Rv3911 sigM ECF RNA polymerase sigma factor SigM 730 731 ctx neighborhood:724
Rv3907c pcnA poly(A) polymerase PcnA 689 689 ctx neighborhood:679
Rv3906c hyp hypothetical protein 674 674 ctx neighborhood:669
Rv3913 trxB2 thioredoxin reductase 625 607 ctx neighborhood:549
Rv3914 trxC thioredoxin TrxC 570 553 ctx neighborhood:549
Rv3915 cwlM peptidoglycan hydrolase 534 534 ctx neighborhood:449
Rv3676 crp cAMP receptor protein 436 427
Rv2985 mutT1 8-oxo-dGTP diphosphatase 427 212
Rv2214c ephD oxidoreductase EphD 570 93 textmining:546
Rv2412 rpsT 30S ribosomal protein S20 683 85 textmining:668
Rv1316c ogt methylated-DNA--protein-cysteine methyltransferase 821 76 textmining:815
Rv0134 ephF epoxide hydrolase EphF 531 76 textmining:514

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: mutator protein MutT
  • MTBC0 PGAP product: NUDIX hydrolase
  • Pfam (hmmscan --cut_ga): NUDIX PF00293.35 (E=3e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218425.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NUDIX (PF00293.35)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0494
  • Curated reference: UniProt P9WIX7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 20 functional partner(s); context anchor murJ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004142|Rv3908|mutT4
MSDGEQAKSRRRRGRRRGRRAAATAENHMDAQPAGDATPTPATAKRSRSRSPRRGSTRMRTVHETSAGGLVIDGIDGPRDAQVAALIGRVDRRGRLLWSLPKGHIELGETAEQTAIREVAEETGIRGSVLAALGRIDYWFVTDGRRVHKTVHHYLMRFLGGELSDEDLEVAEVAWVPIRELPSRLAYADERRLAEVADELIDKLQSDGPAALPPLPPSSPRRRPQTHSRARHADDSAPGQHNGPGPGP