Rv1321 Resolved · high auto-curated

H37Rv Rv1321 · MTBC0 - · 226 aa · 1484279–1484959 (+) · RefSeq NP_215837.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)endonuclease NucS
MTBC0 PGAP re-annotation
Revised (this work)Endonuclease NucS. Pfam: NucS_N (PF21003.3), NucS_C (PF01939.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WIY5 SwissProt · reviewed · Evidence at protein level
UniProt nameEndonuclease NucS
EC (curated) EC 3.1.-.-
Curated functionCleaves both 3' and 5' ssDNA extremities of branched DNA structures.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namenucS
eggNOG descriptionCleaves both 3' and 5' ssDNA extremities of branched DNA structures
Orthologous groupCOG1637
KEGG orthology K07503

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NucS_NPF21003.3 2.7e-431–99 Endonuclease NucS N-terminal PH-like domain
NucS_CPF01939.22 6.0e-53106–226 Endonuclease NucS C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: whiB1 (transcriptional regulator WhiB1), high confidence from genomic context alone (score 736 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1322 hyp hypothetical protein 959 888 ctx neighborhood:849 textmining:649
Rv3219 whiB1 transcriptional regulator WhiB1 735 736 ctx cooccurence:732
Rv1830 HTH-type transcriptional regulator 734 735 ctx cooccurence:731
Rv1318c adenylate cyclase 723 724 ctx neighborhood:724
Rv3260c whiB2 transcriptional regulator WhiB2 722 723 ctx cooccurence:720
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 714 714 ctx cooccurence:713
Rv2050 rbpA RNA polymerase-binding protein RbpA 691 692 ctx cooccurence:689
Rv1317c alkA bifunctional regulatory protein/DNA repair enzyme AlkA 715 682 ctx neighborhood:678
Rv3195 hyp hypothetical protein 658 659 ctx cooccurence:657
Rv1440 secG protein-export membrane protein SecG 639 639 ctx cooccurence:634
Rv1316c ogt methylated-DNA--protein-cysteine methyltransferase 724 637 ctx neighborhood:634
Rv2699c hyp hypothetical protein 636 637 ctx cooccurence:633
Rv3332 nagA N-acetylglucosamine-6-phosphate deacetylase NagA 617 618 ctx fusion:549
Rv2708c hyp hypothetical protein 611 611 ctx cooccurence:610
Rv2413c hyp hypothetical protein 711 607 ctx cooccurence:598

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): endonuclease NucS
  • Pfam (hmmscan --cut_ga): NucS_N PF21003.3 (E=3e-43), NucS_C PF01939.22 (E=6e-53)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215837.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NucS_N (PF21003.3), NucS_C (PF01939.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1637
  • Curated reference: UniProt P9WIY5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 52 functional partner(s); context anchor whiB1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1321|
MSRVRLVIAQCTVDYIGRLTAHLPSARRLLLFKADGSVSVHADDRAYKPLNWMSPPCWLTEESGGQAPVWVVENKAGEQLRITIEGIEHDSSHELGVDPGLVKDGVEAHLQALLAEHIQLLGEGYTLVRREYMTAIGPVDLLCSDERGGSVAVEIKRRGEIDGVEQLTRYLELLNRDSVLAPVKGVFAAQQIKPQARILATDRGIRCLTLDYDTMRGMDSGEYRLF