crgA Resolved · high auto-curated
H37Rv Rv0011c · MTBC0 mtbc0_000015 ·
93 aa · 13714–13995 (-) ·
RefSeq NP_214525.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | cell division protein CrgA |
|---|---|
| MTBC0 PGAP re-annotation | cell division protein CrgA |
| Revised (this work) | Cell division protein CrgA. Pfam: CrgA (PF06781.18). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WP57
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Cell division protein CrgA |
| Curated function | Involved in cell division. Plays an important role in septal peptidoglycan synthesis and cell shape morphogenesis. May facilitate the recruitment of the peptidoglycan synthesis machinery to poles and septal zones and coordinate peptidoglycan synthesis at these sites. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
D Cell cycle control, cell division, chromosome partitioning
|
|---|---|
| Preferred name | crgA |
| eggNOG description | Cell division protein CrgA |
| Orthologous group | 2B592 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
CrgA | PF06781.18 | 1.1e-27 | 1–93 | Cell division protein CrgA |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0010c (membrane protein), high confidence from genomic context alone (score 797 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0010c |
membrane protein | 903 | 797 ctx | neighborhood:749 textmining:545 |
Rv0012 |
membrane protein | 784 | 785 ctx | neighborhood:782 |
Rv0013 trpG |
anthranilate synthase component II | 749 | 749 ctx | neighborhood:747 |
Rv3311 hyp |
hypothetical protein | 663 | 663 ctx | cooccurence:661 |
Rv2170 |
GCN5-like N-acetyltransferase | 638 | 638 ctx | cooccurence:638 |
Rv3259 hyp |
hypothetical protein | 613 | 613 ctx | cooccurence:611 |
Rv2520c |
membrane protein | 596 | 597 ctx | cooccurence:594 |
Rv3212 hyp |
hypothetical protein | 542 | 543 ctx | cooccurence:538 |
Rv0016c pbpA |
penicillin-binding protein PbpA | 901 | 522 | textmining:802 |
Rv2150c ftsZ |
cell division protein FtsZ | 875 | 514 | experimental:500 textmining:754 |
Rv2163c pbpB |
penicillin-binding membrane protein PbpB | 900 | 506 | textmining:806 |
Rv0008c cwsA |
cell wall synthesis protein CwsA | 937 | 501 | experimental:500 textmining:879 |
Rv3782 glfT1 |
galactofuranosyl transferase GlfT | 485 | 486 ctx | cooccurence:471 |
Rv1417 |
membrane protein | 485 | 485 ctx | cooccurence:480 |
Rv1222 rseA |
anti-sigma E factor RseA | 448 | 449 ctx | cooccurence:447 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: cell division protein CrgA
- MTBC0 PGAP product: cell division protein CrgA
- Pfam (hmmscan --cut_ga): CrgA PF06781.18 (E=1e-27)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214525.1)
- Domains: Pfam-A via hmmscan --cut_ga — CrgA (PF06781.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2B592 - Curated reference: UniProt P9WP57 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
50 functional partner(s); context anchor
Rv0010c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000015|Rv0011c|crgA MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH