Rv2735c Resolved · medium auto-curated
H37Rv Rv2735c · MTBC0 mtbc0_002909 ·
330 aa · 3069975–3070967 (-) ·
RefSeq NP_217251.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | three-Cys-motif partner protein TcmP |
| Revised (this work) | Three-Cys-motif partner protein TcmP. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6Y1K7
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Three-Cys-motif partner protein TcmP |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2DBDD |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.765 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 8 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.10% of strains (152) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: recX (regulatory protein RecX), high confidence from genomic context alone (score 889 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2736c recX |
regulatory protein RecX | 960 | 889 ctx | neighborhood:882 textmining:655 |
Rv2737c recA |
recombinase A | 901 | 841 ctx | neighborhood:801 textmining:403 |
Rv0355c PPE8 |
PPE family protein PPE8 | 758 | 759 ctx | cooccurence:755 |
Rv3347c PPE55 |
PPE family protein PPE55 | 758 | 758 ctx | cooccurence:755 |
Rv2209 |
integral membrane protein | 755 | 756 ctx | cooccurence:755 |
Rv3350c PPE56 |
PPE family protein PPE56 | 753 | 754 ctx | cooccurence:752 |
Rv1452c PE_PGRS28 |
PE-PGRS family protein PE_PGRS28 | 753 | 753 ctx | cooccurence:753 |
Rv1917c PPE34 |
PPE family protein PPE34 | 752 | 753 ctx | cooccurence:751 |
Rv0304c PPE5 |
PPE family protein PPE5 | 752 | 753 ctx | cooccurence:750 |
Rv2490c PE_PGRS43 |
PE-PGRS family protein PE_PGRS43 | 743 | 743 ctx | cooccurence:743 |
Rv3343c PPE54 |
PPE family protein PPE54 | 741 | 741 ctx | cooccurence:737 |
Rv1004c |
membrane protein | 737 | 737 ctx | cooccurence:737 |
Rv1651c PE_PGRS30 |
PE-PGRS family protein PE_PGRS30 | 735 | 735 ctx | cooccurence:735 |
Rv0613c hyp |
hypothetical protein | 729 | 729 ctx | cooccurence:729 |
Rv0872c PE_PGRS15 |
PE-PGRS family protein PE_PGRS15 | 729 | 729 ctx | cooccurence:729 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: three-Cys-motif partner protein TcmP
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217251.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DBDD - Curated reference: UniProt I6Y1K7 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
105 functional partner(s); context anchor
recX - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002909|Rv2735c| MAREWSYWTRNKLEILAGYLPAFNRASQTSRERIYLDLMAGQPENIDRDMGEKFDGSSLIAMKADPPFTRLRFCELNPLASELDVALRTRFPGDGRYRVVAGDSNVTIDETLAELGPWRWAPTFAFIDQQAAEVHWETINKVAAFRQNPRNLKTELWMLMSPTMIARGVKGTNAELFIEQVTRMYGDADWKRIQAARWRHHLTAPAYRAEMVNLMRVKLEYELGYKYSHRIPMQMHNKVTIFDMVFATDHWAGDAIMCHLYNRAAQKEPEMMRQAKSAKQQKESEDRGEMGLFSVGELAVQDSNAGQILWAPSPTWDPRARGWWSEDPGF