Rv2735c Resolved · medium auto-curated

H37Rv Rv2735c · MTBC0 mtbc0_002909 · 330 aa · 3069975–3070967 (-) · RefSeq NP_217251.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationthree-Cys-motif partner protein TcmP
Revised (this work)Three-Cys-motif partner protein TcmP.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y1K7 TrEMBL · unreviewed · Evidence at protein level
UniProt nameThree-Cys-motif partner protein TcmP

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2DBDD

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.765 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 8 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.10% of strains (152) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: recX (regulatory protein RecX), high confidence from genomic context alone (score 889 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2736c recX regulatory protein RecX 960 889 ctx neighborhood:882 textmining:655
Rv2737c recA recombinase A 901 841 ctx neighborhood:801 textmining:403
Rv0355c PPE8 PPE family protein PPE8 758 759 ctx cooccurence:755
Rv3347c PPE55 PPE family protein PPE55 758 758 ctx cooccurence:755
Rv2209 integral membrane protein 755 756 ctx cooccurence:755
Rv3350c PPE56 PPE family protein PPE56 753 754 ctx cooccurence:752
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 753 753 ctx cooccurence:753
Rv1917c PPE34 PPE family protein PPE34 752 753 ctx cooccurence:751
Rv0304c PPE5 PPE family protein PPE5 752 753 ctx cooccurence:750
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 743 743 ctx cooccurence:743
Rv3343c PPE54 PPE family protein PPE54 741 741 ctx cooccurence:737
Rv1004c membrane protein 737 737 ctx cooccurence:737
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 735 735 ctx cooccurence:735
Rv0613c hyp hypothetical protein 729 729 ctx cooccurence:729
Rv0872c PE_PGRS15 PE-PGRS family protein PE_PGRS15 729 729 ctx cooccurence:729

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: three-Cys-motif partner protein TcmP
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217251.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DBDD
  • Curated reference: UniProt I6Y1K7 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 105 functional partner(s); context anchor recX
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002909|Rv2735c|
MAREWSYWTRNKLEILAGYLPAFNRASQTSRERIYLDLMAGQPENIDRDMGEKFDGSSLIAMKADPPFTRLRFCELNPLASELDVALRTRFPGDGRYRVVAGDSNVTIDETLAELGPWRWAPTFAFIDQQAAEVHWETINKVAAFRQNPRNLKTELWMLMSPTMIARGVKGTNAELFIEQVTRMYGDADWKRIQAARWRHHLTAPAYRAEMVNLMRVKLEYELGYKYSHRIPMQMHNKVTIFDMVFATDHWAGDAIMCHLYNRAAQKEPEMMRQAKSAKQQKESEDRGEMGLFSVGELAVQDSNAGQILWAPSPTWDPRARGWWSEDPGF