Rv2734 Family assigned · low auto-curated
H37Rv Rv2734 · MTBC0 mtbc0_002908 ·
284 aa · 3069236–3070090 (+) ·
RefSeq NP_217250.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF5131 family protein |
| Revised (this work) | DUF5131 family protein. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6YA42
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Phage Gp37Gp68 family protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF5131) |
| Orthologous group | COG4422 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.063 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF5131 | PF07505.18 | 2.5e-102 | 5–243 | Protein of unknown function (DUF5131) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: miaB ((dimethylallyl)adenosine tRNA methylthiotransferase), medium confidence from genomic context alone (score 426 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2735c hyp |
hypothetical protein | 824 | 514 | textmining:654 |
Rv2733c miaB |
(dimethylallyl)adenosine tRNA methylthiotransferase | 425 | 426 ctx | neighborhood:426 |
Rv2732c |
transmembrane protein | 420 | 420 ctx | neighborhood:418 |
Rv2736c recX |
regulatory protein RecX | 461 | 86 | textmining:435 |
Rv1317c alkA |
bifunctional regulatory protein/DNA repair enzyme AlkA | 402 | 84 | |
Rv1316c ogt |
methylated-DNA--protein-cysteine methyltransferase | 456 | 67 | textmining:441 |
Rv0723 rplO |
50S ribosomal protein L15 | 580 | 46 | textmining:578 |
Rv3146 nuoB |
NADH-quinone oxidoreductase subunit B | 432 | 46 | textmining:430 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: DUF5131 family protein
- Pfam (hmmscan --cut_ga): DUF5131 PF07505.18 (E=3e-102)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217250.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF5131 (PF07505.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4422 - Curated reference: UniProt I6YA42 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
8 functional partner(s); context anchor
miaB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002908|Rv2734| MSDRSAIEWTGATWNPVTGCDRVSPGCDHCYAMTLAKRLKAMGSDKYQTDGDPRTSGPGFGVTIHPRSLDEPFRWRSPRTVFVNSMADLFHARVALWFIREVFEVMRATPQHTYQILTKRSLRLRRLAHKLEWPSNVWMGVSVENVDAFRRIEDLRQVPAAVRFLSCEPLLGPLDGINLGSIDWVIAGGESGPNFRPIDPQWVRHIRDTCTAADVPFFFKQWGGRTPKAFGRELDGRCWDEMPLIEIRNPDPRTTSRVHADPMLATAPTESAQRSNPGQLVRQR