Rv2734 Family assigned · low auto-curated

H37Rv Rv2734 · MTBC0 mtbc0_002908 · 284 aa · 3069236–3070090 (+) · RefSeq NP_217250.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF5131 family protein
Revised (this work)DUF5131 family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YA42 TrEMBL · unreviewed · Evidence at protein level
UniProt namePhage Gp37Gp68 family protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF5131)
Orthologous groupCOG4422

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.063 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF5131PF07505.18 2.5e-1025–243 Protein of unknown function (DUF5131)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: miaB ((dimethylallyl)adenosine tRNA methylthiotransferase), medium confidence from genomic context alone (score 426 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2735c hyp hypothetical protein 824 514 textmining:654
Rv2733c miaB (dimethylallyl)adenosine tRNA methylthiotransferase 425 426 ctx neighborhood:426
Rv2732c transmembrane protein 420 420 ctx neighborhood:418
Rv2736c recX regulatory protein RecX 461 86 textmining:435
Rv1317c alkA bifunctional regulatory protein/DNA repair enzyme AlkA 402 84
Rv1316c ogt methylated-DNA--protein-cysteine methyltransferase 456 67 textmining:441
Rv0723 rplO 50S ribosomal protein L15 580 46 textmining:578
Rv3146 nuoB NADH-quinone oxidoreductase subunit B 432 46 textmining:430

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF5131 family protein
  • Pfam (hmmscan --cut_ga): DUF5131 PF07505.18 (E=3e-102)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217250.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF5131 (PF07505.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4422
  • Curated reference: UniProt I6YA42 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 8 functional partner(s); context anchor miaB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002908|Rv2734|
MSDRSAIEWTGATWNPVTGCDRVSPGCDHCYAMTLAKRLKAMGSDKYQTDGDPRTSGPGFGVTIHPRSLDEPFRWRSPRTVFVNSMADLFHARVALWFIREVFEVMRATPQHTYQILTKRSLRLRRLAHKLEWPSNVWMGVSVENVDAFRRIEDLRQVPAAVRFLSCEPLLGPLDGINLGSIDWVIAGGESGPNFRPIDPQWVRHIRDTCTAADVPFFFKQWGGRTPKAFGRELDGRCWDEMPLIEIRNPDPRTTSRVHADPMLATAPTESAQRSNPGQLVRQR