Rv0880 Family assigned · medium auto-curated

H37Rv Rv0880 · MTBC0 mtbc0_000935 · 143 aa · 982148–982579 (+) · RefSeq NP_215395.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)HTH-type transcriptional regulator
MTBC0 PGAP re-annotationMarR family transcriptional regulator
Revised (this work)MarR family transcriptional regulator. Pfam: MarR_2 (PF12802.14), MarR (PF01047.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMF1 SwissProt · reviewed · Evidence at protein level
UniProt nameHTH-type transcriptional regulator Rv0880
Curated functionPart of a regulatory network that coordinates tolerance to the antitubercular drug bedaquiline.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptiontranscriptional
Orthologous groupCOG1846

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.38 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MarR_2PF12802.14 2.9e-0732–89 MarR family
MarRPF01047.29 4.0e-1433–90 MarR family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0882 (transmembrane protein), high confidence from genomic context alone (score 883 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0882 transmembrane protein 883 883 ctx neighborhood:882
Rv0881 tRNA/rRNA methyltransferase 883 882 ctx neighborhood:882
Rv0879c transmembrane protein 766 766 ctx neighborhood:765
Rv2175c DNA-binding protein 730 730 coexpression:730
Rv0744c transcriptional regulator 651 651 coexpression:651
Rv0653c transcriptional regulator 580 580 coexpression:580
Rv3143 response regulator 528 510
Rv3692 moxR2 methanol dehydrogenase transcriptional regulator MoxR 495 495 coexpression:494
Rv2738c hyp hypothetical protein 449 450 ctx cooccurence:448
Rv0430 hyp hypothetical protein 435 435 ctx cooccurence:430
Rv3291c lrpA transcriptional regulator LrpA 457 432 coexpression:432
Rv0452 transcriptional regulator 415 415 coexpression:415
Rv2096c pafB proteasome accessory factor B 428 414
Rv3830c TetR family transcriptional regulator 409 409 coexpression:409
Rv2199c ctaF cytochrome c oxidase polypeptide 4 524 222 textmining:413

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: HTH-type transcriptional regulator
  • MTBC0 PGAP product: MarR family transcriptional regulator
  • Pfam (hmmscan --cut_ga): MarR_2 PF12802.14 (E=3e-07), MarR PF01047.29 (E=4e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215395.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MarR_2 (PF12802.14), MarR (PF01047.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1846
  • Curated reference: UniProt P9WMF1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 35 functional partner(s); context anchor Rv0882
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000935|Rv0880|
MLDSDARLASDLSLAVMRLSRQLRFRNPSSPVSLSQLSALTTLANEGAMTPGALAIRERVRPPSMTRVIASLADMGFVDRAPHPIDGRQVLVSVSESGAELVKAARRARQEWLAERLATLNRSERDILRSAADLMLALVDESP