ruvC Resolved · high auto-curated

H37Rv Rv2594c · MTBC0 mtbc0_002761 · 188 aa · 2948370–2948936 (-) · RefSeq NP_217110.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)crossover junction endodeoxyribonuclease RuvC
MTBC0 PGAP re-annotationcrossover junction endodeoxyribonuclease RuvC
Revised (this work)Crossover junction endodeoxyribonuclease RuvC. Pfam: RuvC (PF02075.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGV9 SwissProt · reviewed · Inferred from homology
UniProt nameCrossover junction endodeoxyribonuclease RuvC
EC (curated) EC 3.1.21.10
Curated functionThe RuvA-RuvB-RuvC complex processes Holliday junction (HJ) DNA during genetic recombination and DNA repair. Endonuclease that resolves HJ intermediates. Cleaves cruciform DNA by making single-stranded nicks across the HJ at symmetrical positions within the homologous arms, yielding a 5'-phosphate and a 3'-hydroxyl group; requires a central core of homology in the junction. The consensus cleavage sequence is 5'-(A/T)TT(C/G)-3'. Cleavage occurs on the 3'-side of the TT dinucleotide at the point of strand exchange. HJ branch migration catalyzed by RuvA-RuvB allows RuvC to scan DNA until it finds.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred nameruvC
eggNOG descriptionNuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group
Orthologous groupCOG0817
EC number EC 3.1.22.4
KEGG orthology K01159
KEGG pathways map03440
Gene Ontology (54) GO:0000725, GO:0003674, GO:0003824, GO:0004518, GO:0004519, GO:0004520, GO:0004536, GO:0005575, GO:0005622, GO:0005623, GO:0006139, GO:0006259 +42 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RuvCPF02075.24 1.1e-613–152 Crossover junction endodeoxyribonuclease RuvC

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ruvA (Holliday junction ATP-dependent DNA helicase RuvA), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2593c ruvA Holliday junction ATP-dependent DNA helicase RuvA 999 998 ctx neighborhood:882 coexpression:910 experimental:699 textmining:933
Rv2592c ruvB Holliday junction ATP-dependent DNA helicase RuvB 999 994 ctx neighborhood:882 cooccurence:529 coexpression:878 textmining:922
Rv2897c hyp hypothetical protein 719 689 ctx cooccurence:683
Rv2736c recX regulatory protein RecX 859 674 coexpression:663 textmining:588
Rv2898c hyp hypothetical protein 606 606 ctx cooccurence:592
Rv2600 integral membrane protein 602 602 ctx neighborhood:601
Rv2596 vapC40 ribonuclease VapC40 570 571 ctx neighborhood:567
Rv0429c def polypeptide deformylase 621 559 ctx cooccurence:478
Rv2595 vapB40 antitoxin VapB40 554 555 ctx neighborhood:552
Rv2926c hyp hypothetical protein 489 490 ctx cooccurence:452
Rv2603c transcriptional regulator 496 419
Rv2586c secF protein translocase subunit SecF 410 411
Rv2597 membrane protein 408 409 ctx neighborhood:408
Rv2152c murC UDP-N-acetylmuramate--alanine ligase 405 406
Rv2965c kdtB phosphopantetheine adenylyltransferase 405 405

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: crossover junction endodeoxyribonuclease RuvC
  • MTBC0 PGAP product: crossover junction endodeoxyribonuclease RuvC
  • Pfam (hmmscan --cut_ga): RuvC PF02075.24 (E=1e-61)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217110.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RuvC (PF02075.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0817
  • Curated reference: UniProt P9WGV9 (SwissProt, reviewed; Inferred from homology)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 55 functional partner(s); context anchor ruvA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002761|Rv2594c|ruvC
MRVMGVDPGLTRCGLSLIESGRGRQLTALDVDVVRTPSDAALAQRLLAISDAVEHWLDTHHPEVVAIERVFSQLNVTTVMGTAQAGGVIALAAAKRGVDVHFHTPSEVKAAVTGNGSADKAQVTAMVTKILALQAKPTPADAADALALAICHCWRAPTIARMAEATSRAEARAAQQRHAYLAKLKAAR