recO Resolved · high auto-curated
H37Rv Rv2362c · MTBC0 mtbc0_002514 ·
265 aa ·
2667654–2668451 MTBC0
(-) ·
RefSeq NP_216878.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | DNA repair protein RecO |
|---|---|
| MTBC0 PGAP re-annotation | DNA repair protein RecO |
| Revised (this work) | DNA repair protein RecO. Pfam: RecO_N (PF11967.15), RecO_C (PF02565.22). |
| Functional category (TubercuList) | information pathways |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 6 publications
6 TB publications mention this gene. 6 publication(s) discuss this gene (1 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Implementation of the national community health policy in Guinea: a decision space analysis of the roles and responsibilities of community health workers. doi:10.1007/s00103-025-04076-8 | 2025 |
| Homologous recombination mediated by the mycobacterial AdnAB helicase without end resection by the AdnAB nucleases. doi:10.1093/nar/gkw1130 | 2017 |
| A comparative analysis of the DNA recombination repair pathway in mycobacterial genomes. doi:10.1016/j.tube.2016.04.011 | 2016 |
| RecF and RecR Play Critical Roles in the Homologous Recombination and Single-Strand Annealing Pathways of Mycobacteria. doi:10.1128/JB.00290-15 | 2015 |
| RecO protein initiates DNA recombination and strand annealing through two alternative DNA binding mechanisms. doi:10.1074/jbc.M114.585117 | 2014 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | uppS (Rv2361c, - strand) |
|---|---|
| Overlap | 8 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -5.53 (95% CI -6.18 to -4.83). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in DNA repair and RECF pathway recombination |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2383c
· 100.0% identity |
|---|---|
| M. leprae |
ML0633
· 86.6% identity |
| M. marinum |
MMAR_3672
· 93.9% identity |
| M. smegmatis |
MSMEG_4491
· 81.1% identity |
| M. orygis |
RJtmp_002440
· 100.0% identity |
| M. abscessus |
MAB_1675
· 78.9% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHI5
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | DNA repair protein RecO |
| Curated function | Involved in DNA repair and RecF pathway recombination. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
L Replication, recombination and repair
|
|---|---|
| Preferred name | recO |
| eggNOG description | Involved in DNA repair and RecF pathway recombination |
| Orthologous group | COG1381 |
| KEGG orthology |
K03584
|
| KEGG pathways |
map03440
|
| Gene Ontology (6) |
GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.186 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 89.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 58.8% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) ESD — not strictly essential
| DeJesus 2017 call | ESD · essential domain |
|---|---|
| What the call means | essential domain: only a SUB-REGION of the ORF is essential; the gene as a whole is NOT essential. Locate the domain before concluding, and beware that a region devoid of TA sites is invisible to Himar1 TnSeq (neither essential nor dispensable can be inferred). |
| TA sites (Himar1) | 12 in the ORF — 3 in the essential state, 0 growth-defect, 9 non-essential, 0 growth-advantage. Saturation 0.833, mean read count 28.8. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | `essential: true` here is the broad union (ES+ESD+GD) kept for backward compatibility; this gene is NOT strictly essential. Read n_sites_* before writing anything about essentiality. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | +4.80 | 0.0 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 2 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 0.1 ppm · rank 3467/3519 (1.5th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 265 aa |
|---|---|
| Molecular weight | 28.7 kDa |
| Theoretical pI | 9.02 |
| GRAVY | -0.069 (hydrophilic) |
| Aliphatic index | 96.2 |
| Aromaticity | 0.053 |
| Instability index | 41.4 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
RecO_N | PF11967.15 | 2.2e-26 | 1–79 | Recombination protein O N terminal |
RecO_C | PF02565.22 | 5.5e-31 | 86–237 | Recombination protein O C terminal |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.7
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1w3s-assembly1_A |
1.00 | 0.83 | 6.1e-13 sig | 1w3s-assembly1_A The crystal structure of RecO from Deinococcus radiodurans. |
1u5k-assembly1_B |
1.00 | 0.83 | 8.4e-13 sig | 1u5k-assembly1_B Recombinational repair protein RecO |
1u5k-assembly1_A |
1.00 | 0.80 | 4.7e-13 sig | 1u5k-assembly1_A Recombinational repair protein RecO |
2v1c-assembly1_C-2 |
1.00 | 0.82 | 1.6e-12 sig | 2v1c-assembly1_C-2 Crystal structure and mutational study of RecOR provide insight into its role in DNA repair |
3q8d-assembly1_A |
1.00 | 0.80 | 3.2e-12 sig | 3q8d-assembly1_A E. coli RecO complex with SSB C-terminus |
Foldseek search of the AlphaFold DB model (mean pLDDT 90.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv2361c (- strand, -8 bp gap) |
|---|---|
| Downstream (3' on genome) | amiA2 (+ strand, 61 bp gap) |
| Predicted operon |
Rv2360c · Rv2361c · recO
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
cmtR (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: uppS (decaprenyl diphosphate synthase), high confidence from genomic context alone (score 890 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3715c recR exp |
recombination protein RecR | 984 | 940 | experimental:912 textmining:746 |
Rv2361c uppS |
decaprenyl diphosphate synthase | 932 | 890 ctx | neighborhood:882 textmining:411 |
Rv2360c hyp |
hypothetical protein | 902 | 887 ctx | neighborhood:882 |
Rv2363 amiA2 |
amidase | 810 | 787 ctx | neighborhood:786 |
Rv2368c phoH1 |
phosphate starvation-inducible protein PhoH | 790 | 783 | coexpression:730 |
Rv3644c |
DNA polymerase | 649 | 602 ctx | cooccurence:424 |
Rv3859c gltB |
glutamate synthase large subunit | 544 | 544 ctx | neighborhood:544 |
Rv2364c era |
GTPase Era | 769 | 543 | coexpression:431 textmining:517 |
Rv1390 rpoZ |
DNA-directed RNA polymerase subunit omega | 504 | 504 | |
Rv2478c hyp |
hypothetical protein | 537 | 475 | |
Rv2903c lepB |
signal peptidase | 467 | 467 ctx | cooccurence:401 |
Rv0343 iniC |
iIsoniazid inductible protein IniC | 526 | 463 | coexpression:432 |
Rv2365c hyp |
hypothetical protein | 461 | 440 | |
Rv2455c korA |
2-oxoglutarate oxidoreductase subunit KorA | 424 | 425 | |
Rv3195 hyp |
hypothetical protein | 412 | 413 ctx | cooccurence:407 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: DNA repair protein RecO
- MTBC0 PGAP product: DNA repair protein RecO
- Pfam (hmmscan --cut_ga): RecO_N PF11967.15 (E=2e-26), RecO_C PF02565.22 (E=5e-31)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216878.1)
- Domains: Pfam-A via hmmscan --cut_ga — RecO_N (PF11967.15), RecO_C (PF02565.22)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1381 - Curated reference: UniProt P9WHI5 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.7)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
70 functional partner(s); context anchor
uppS - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002514|Rv2362c|recO MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTRSKFGARLEPFAHIEVQLHPGRNLDIVTQVVSVDAFATDIVADYGRYTCGCAILETAERLAGEERAPAPALHRLTVGALRAVADGQRPRDLLLDAYLLRAMGIAGWAPALTECARCATPGPHRAFHIATGGSVCAHCRPAGSTTPPLGVVDLMSALYDGDWEAAEAAPQSARSHVSGLVAAHLQWHLERQLKTLPLVERFYQADRSVAERRAALIGQDIAGG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for recO? Email the maintainer — the message is pre-filled with this gene's details.