recO Resolved · high auto-curated

H37Rv Rv2362c · MTBC0 mtbc0_002514 · 265 aa · 2667654–2668451 (-) · RefSeq NP_216878.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)DNA repair protein RecO
MTBC0 PGAP re-annotationDNA repair protein RecO
Revised (this work)DNA repair protein RecO. Pfam: RecO_N (PF11967.15), RecO_C (PF02565.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHI5 SwissProt · reviewed · Inferred from homology
UniProt nameDNA repair protein RecO
Curated functionInvolved in DNA repair and RecF pathway recombination.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namerecO
eggNOG descriptionInvolved in DNA repair and RecF pathway recombination
Orthologous groupCOG1381
KEGG orthology K03584
KEGG pathways map03440
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.186 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RecO_NPF11967.15 2.2e-261–79 Recombination protein O N terminal
RecO_CPF02565.22 5.5e-3186–237 Recombination protein O C terminal

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: uppS (decaprenyl diphosphate synthase), high confidence from genomic context alone (score 890 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3715c recR recombination protein RecR 984 940 experimental:912 textmining:746
Rv2361c uppS decaprenyl diphosphate synthase 932 890 ctx neighborhood:882 textmining:411
Rv2360c hyp hypothetical protein 902 887 ctx neighborhood:882
Rv2363 amiA2 amidase 810 787 ctx neighborhood:786
Rv2368c phoH1 phosphate starvation-inducible protein PhoH 790 783 coexpression:730
Rv3644c DNA polymerase 649 602 ctx cooccurence:424
Rv3859c gltB glutamate synthase large subunit 544 544 ctx neighborhood:544
Rv2364c era GTPase Era 769 543 coexpression:431 textmining:517
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 504 504
Rv2478c hyp hypothetical protein 537 475
Rv2903c lepB signal peptidase 467 467 ctx cooccurence:401
Rv0343 iniC iIsoniazid inductible protein IniC 526 463 coexpression:432
Rv2365c hyp hypothetical protein 461 440
Rv2455c korA 2-oxoglutarate oxidoreductase subunit KorA 424 425
Rv3195 hyp hypothetical protein 412 413 ctx cooccurence:407

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: DNA repair protein RecO
  • MTBC0 PGAP product: DNA repair protein RecO
  • Pfam (hmmscan --cut_ga): RecO_N PF11967.15 (E=2e-26), RecO_C PF02565.22 (E=5e-31)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216878.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RecO_N (PF11967.15), RecO_C (PF02565.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1381
  • Curated reference: UniProt P9WHI5 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 70 functional partner(s); context anchor uppS
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002514|Rv2362c|recO
MRLYRDRAVVLRQHKLGEADRIVTLLTRDHGLVRAVAKGVRRTRSKFGARLEPFAHIEVQLHPGRNLDIVTQVVSVDAFATDIVADYGRYTCGCAILETAERLAGEERAPAPALHRLTVGALRAVADGQRPRDLLLDAYLLRAMGIAGWAPALTECARCATPGPHRAFHIATGGSVCAHCRPAGSTTPPLGVVDLMSALYDGDWEAAEAAPQSARSHVSGLVAAHLQWHLERQLKTLPLVERFYQADRSVAERRAALIGQDIAGG