PE_PGRS37 Family assigned · low auto-curated

H37Rv Rv2126c · MTBC0 - · 256 aa · 2387202–2387972 (-) · RefSeq YP_177862.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PE-PGRS family protein PE_PGRS37
MTBC0 PGAP re-annotation
Revised (this work)PE-PGRS family protein PE_PGRS37.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L0TBL4 TrEMBL · unreviewed · Predicted
UniProt namePE-PGRS family protein PE_PGRS37

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.545 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (178) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PE_PGRS23 (PE-PGRS family protein PE_PGRS23), high confidence from genomic context alone (score 773 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1243c PE_PGRS23 PE-PGRS family protein PE_PGRS23 773 773 ctx cooccurence:773
Rv3176c mesT epoxide hydrolase MesT 767 767 ctx cooccurence:767
Rv2853 PE_PGRS48 PE-PGRS family protein PE_PGRS48 752 752 ctx cooccurence:752
Rv0124 PE_PGRS2 PE-PGRS family protein PE_PGRS2 751 751 ctx cooccurence:751
Rv1918c PPE35 PPE family protein PPE35 731 731 ctx cooccurence:731
Rv2353c PPE39 PPE family protein PPE39 737 730 ctx cooccurence:730
Rv1753c PPE24 PPE family protein PPE24 716 716 ctx cooccurence:716
Rv2356c PPE40 Rv2356c, (MTCY98.25), len: 615 aa. PPE40, Member of Mycobacterium tuberculosis PPE_family, highly similar to others e.g. Q10778|MTCY48.17|YF 714 714 ctx cooccurence:714
Rv3159c PPE53 PPE family protein PPE53 712 712 ctx cooccurence:712
Rv0305c PPE6 PPE family protein PPE6 725 706 ctx cooccurence:706
Rv0304c PPE5 PPE family protein PPE5 706 706 ctx cooccurence:706
Rv1004c membrane protein 704 705 ctx cooccurence:704
Rv1834 lipZ hydrolase 700 700 ctx cooccurence:700
Rv1703c methyltransferase 696 696 ctx cooccurence:696
Rv3533c PPE62 PPE family protein PPE62 685 685 ctx cooccurence:685

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE-PGRS family protein PE_PGRS37
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177862.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt L0TBL4 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 59 functional partner(s); context anchor PE_PGRS23
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2126c|PE_PGRS37
MIGDGANGGPGQPGGPGGLLYGNGGHGGAGAAGQDRGAGNSAGLIGNGGAGGAGGNGGIGGAGAPGGLGGDGGKGGFADEFTGGFAQGGRGGFGGNGNTGASGGMGGAGGAGGAGGAGGLLIGDGGAGGAGGIGGAGGVGGGGGAGGTGGGGVASAFGGGNAFGGRGGDGGDGGDGGTGGAGGARGAGGAGGAGGWLSGHSGAHGAMGSGGEGGAGGGGGARGEAGAGGGTSTGTNPGKAGAPGTQGDSGDPGPPG