PE_PGRS37 Family assigned · low auto-curated
H37Rv Rv2126c · MTBC0 - ·
256 aa · 2387202–2387972 (-) ·
RefSeq YP_177862.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PE-PGRS family protein PE_PGRS37 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PE-PGRS family protein PE_PGRS37. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
L0TBL4
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | PE-PGRS family protein PE_PGRS37 |
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.545 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 4 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (178) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PE_PGRS23 (PE-PGRS family protein PE_PGRS23), high confidence from genomic context alone (score 773 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1243c PE_PGRS23 |
PE-PGRS family protein PE_PGRS23 | 773 | 773 ctx | cooccurence:773 |
Rv3176c mesT |
epoxide hydrolase MesT | 767 | 767 ctx | cooccurence:767 |
Rv2853 PE_PGRS48 |
PE-PGRS family protein PE_PGRS48 | 752 | 752 ctx | cooccurence:752 |
Rv0124 PE_PGRS2 |
PE-PGRS family protein PE_PGRS2 | 751 | 751 ctx | cooccurence:751 |
Rv1918c PPE35 |
PPE family protein PPE35 | 731 | 731 ctx | cooccurence:731 |
Rv2353c PPE39 |
PPE family protein PPE39 | 737 | 730 ctx | cooccurence:730 |
Rv1753c PPE24 |
PPE family protein PPE24 | 716 | 716 ctx | cooccurence:716 |
Rv2356c PPE40 |
Rv2356c, (MTCY98.25), len: 615 aa. PPE40, Member of Mycobacterium tuberculosis PPE_family, highly similar to others e.g. Q10778|MTCY48.17|YF | 714 | 714 ctx | cooccurence:714 |
Rv3159c PPE53 |
PPE family protein PPE53 | 712 | 712 ctx | cooccurence:712 |
Rv0305c PPE6 |
PPE family protein PPE6 | 725 | 706 ctx | cooccurence:706 |
Rv0304c PPE5 |
PPE family protein PPE5 | 706 | 706 ctx | cooccurence:706 |
Rv1004c |
membrane protein | 704 | 705 ctx | cooccurence:704 |
Rv1834 lipZ |
hydrolase | 700 | 700 ctx | cooccurence:700 |
Rv1703c |
methyltransferase | 696 | 696 ctx | cooccurence:696 |
Rv3533c PPE62 |
PPE family protein PPE62 | 685 | 685 ctx | cooccurence:685 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE-PGRS family protein PE_PGRS37
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177862.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Curated reference: UniProt L0TBL4 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
59 functional partner(s); context anchor
PE_PGRS23 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2126c|PE_PGRS37 MIGDGANGGPGQPGGPGGLLYGNGGHGGAGAAGQDRGAGNSAGLIGNGGAGGAGGNGGIGGAGAPGGLGGDGGKGGFADEFTGGFAQGGRGGFGGNGNTGASGGMGGAGGAGGAGGAGGLLIGDGGAGGAGGIGGAGGVGGGGGAGGTGGGGVASAFGGGNAFGGRGGDGGDGGDGGTGGAGGARGAGGAGGAGGWLSGHSGAHGAMGSGGEGGAGGGGGARGEAGAGGGTSTGTNPGKAGAPGTQGDSGDPGPPG