erm(37) Resolved · high auto-curated

H37Rv Rv1988 · MTBC0 - · 179 aa · 2231680–2232219 (+) · RefSeq NP_216504.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37)
MTBC0 PGAP re-annotation
Revised (this work)23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37). Pfam: RrnaAD (PF00398.27), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q10838 TrEMBL · unreviewed · Inferred from homology
UniProt nameProbable 23S rRNA methyltransferase Erm(37)

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
eggNOG descriptionBelongs to the class I-like SAM-binding methyltransferase superfamily. rRNA adenine N(6)-methyltransferase family
Orthologous groupCOG0030
EC number EC 2.1.1.184
KEGG orthology K00561

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.504 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RrnaADPF00398.27 4.1e-1820–172 Ribosomal RNA adenine dimethylase
Methyltransf_25PF13649.13 3.1e-0836–98 Methyltransferase domain
Methyltransf_11PF08241.19 6.8e-0638–96 Methyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv3458c rpsD 30S ribosomal protein S4 885 870 experimental:800
Rv3442c rpsI 30S ribosomal protein S9 855 836 experimental:784
Rv0700 rpsJ 30S ribosomal protein S10 848 828 experimental:811
Rv0683 rpsG 30S ribosomal protein S7 846 826 experimental:807
Rv0710 rpsQ 30S ribosomal protein S17 840 819 experimental:805
Rv2785c rpsO 30S ribosomal protein S15 839 818 experimental:811
Rv0721 rpsE 30S ribosomal protein S5 839 818 experimental:811
Rv2890c rpsB 30S ribosomal protein S2 886 817 experimental:808 textmining:403
Rv3459c rpsK 30S ribosomal protein S11 837 816 experimental:806
Rv0682 rpsL 30S ribosomal protein S12 834 812 experimental:805
Rv0718 rpsH 30S ribosomal protein S8 832 810 experimental:802
Rv2416c eis enhanced intracellular survival protein 832 805 coexpression:805
Rv0707 rpsC 30S ribosomal protein S3 823 800 experimental:786
Rv0705 rpsS 30S ribosomal protein S19 819 795 experimental:788
Rv0053 rpsF 30S ribosomal protein S6 816 791 experimental:784

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37)
  • Pfam (hmmscan --cut_ga): RrnaAD PF00398.27 (E=4e-18), Methyltransf_25 PF13649.13 (E=3e-08), Methyltransf_11 PF08241.19 (E=7e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216504.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RrnaAD (PF00398.27), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0030
  • Curated reference: UniProt Q10838 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 77 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1988|erm(37)
MSALGRSRRAWGWHRLHDEWAARVVSAAAVRPGELVFDIGAGEGALTAHLVRAGARVVAVELHPRRVGVLRERFPGITVVHADAASIRLPGRPFRVVANPPYGISSRLLRTLLAPNSGLVAADLVLQRALVCKFASRNARRFTLTVGLMLPRRAFLPPPHVDSAVLVVRRRKCGDWQGR