erm(37) Resolved · high auto-curated
H37Rv Rv1988 · MTBC0 - ·
179 aa · 2231680–2232219 (+) ·
RefSeq NP_216504.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37). Pfam: RrnaAD (PF00398.27), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q10838
TrEMBL · unreviewed
· Inferred from homology
|
|---|---|
| UniProt name | Probable 23S rRNA methyltransferase Erm(37) |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
J Translation, ribosomal structure and biogenesis
|
|---|---|
| eggNOG description | Belongs to the class I-like SAM-binding methyltransferase superfamily. rRNA adenine N(6)-methyltransferase family |
| Orthologous group | COG0030 |
| EC number |
EC 2.1.1.184
|
| KEGG orthology |
K00561
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 2.504 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
RrnaAD | PF00398.27 | 4.1e-18 | 20–172 | Ribosomal RNA adenine dimethylase |
Methyltransf_25 | PF13649.13 | 3.1e-08 | 36–98 | Methyltransferase domain |
Methyltransf_11 | PF08241.19 | 6.8e-06 | 38–96 | Methyltransferase domain |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3458c rpsD |
30S ribosomal protein S4 | 885 | 870 | experimental:800 |
Rv3442c rpsI |
30S ribosomal protein S9 | 855 | 836 | experimental:784 |
Rv0700 rpsJ |
30S ribosomal protein S10 | 848 | 828 | experimental:811 |
Rv0683 rpsG |
30S ribosomal protein S7 | 846 | 826 | experimental:807 |
Rv0710 rpsQ |
30S ribosomal protein S17 | 840 | 819 | experimental:805 |
Rv2785c rpsO |
30S ribosomal protein S15 | 839 | 818 | experimental:811 |
Rv0721 rpsE |
30S ribosomal protein S5 | 839 | 818 | experimental:811 |
Rv2890c rpsB |
30S ribosomal protein S2 | 886 | 817 | experimental:808 textmining:403 |
Rv3459c rpsK |
30S ribosomal protein S11 | 837 | 816 | experimental:806 |
Rv0682 rpsL |
30S ribosomal protein S12 | 834 | 812 | experimental:805 |
Rv0718 rpsH |
30S ribosomal protein S8 | 832 | 810 | experimental:802 |
Rv2416c eis |
enhanced intracellular survival protein | 832 | 805 | coexpression:805 |
Rv0707 rpsC |
30S ribosomal protein S3 | 823 | 800 | experimental:786 |
Rv0705 rpsS |
30S ribosomal protein S19 | 819 | 795 | experimental:788 |
Rv0053 rpsF |
30S ribosomal protein S6 | 816 | 791 | experimental:784 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37)
- Pfam (hmmscan --cut_ga): RrnaAD PF00398.27 (E=4e-18), Methyltransf_25 PF13649.13 (E=3e-08), Methyltransf_11 PF08241.19 (E=7e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216504.1)
- Domains: Pfam-A via hmmscan --cut_ga — RrnaAD (PF00398.27), Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0030 - Curated reference: UniProt Q10838 (TrEMBL, unreviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 77 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1988|erm(37) MSALGRSRRAWGWHRLHDEWAARVVSAAAVRPGELVFDIGAGEGALTAHLVRAGARVVAVELHPRRVGVLRERFPGITVVHADAASIRLPGRPFRVVANPPYGISSRLLRTLLAPNSGLVAADLVLQRALVCKFASRNARRFTLTVGLMLPRRAFLPPPHVDSAVLVVRRRKCGDWQGR