Rv3829c Resolved · high auto-curated

H37Rv Rv3829c · MTBC0 mtbc0_004058 · 536 aa · 4327508–4329118 (-) · RefSeq NP_218346.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)dehydrogenase
MTBC0 PGAP re-annotationNAD(P)/FAD-dependent oxidoreductase
Revised (this work)NAD(P)/FAD-dependent oxidoreductase. Pfam: NAD_binding_8 (PF13450.13), Amino_oxidase (PF01593.31).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07794 TrEMBL · unreviewed · Predicted
UniProt namePyridine nucleotide-disulfide oxidoreductase domain-containing protein 2
Curated functionProbable oxidoreductase that may play a role as regulator of mitochondrial function.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionFAD dependent oxidoreductase
Orthologous groupCOG1233

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.367 · purifying
Polymorphic sites (≥ 0.1% of strains) 12 synonymous, 13 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 24.32% of strains (35314) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NAD_binding_8PF13450.13 3.5e-098–62 NAD(P)-binding Rossmann-like domain
Amino_oxidasePF01593.31 1.8e-0915–328 Flavin containing amine oxidoreductase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3830c (TetR family transcriptional regulator), high confidence from genomic context alone (score 888 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3830c TetR family transcriptional regulator 959 888 ctx neighborhood:672 cooccurence:670 textmining:653
Rv3828c resolvase 775 774 ctx neighborhood:773
Rv3827c transposase 775 774 ctx neighborhood:773
Rv3397c phyA phytoene synthase 772 665 coexpression:653
Rv1635c mannosyltransferase 623 623 ctx cooccurence:623
Rv0048c membrane protein 564 564 ctx cooccurence:564
Rv0077c oxidoreductase 555 555 ctx cooccurence:541
Rv0875c hyp hypothetical protein 553 553 ctx cooccurence:553
Rv2407 rnz ribonuclease Z 548 546 ctx cooccurence:541
Rv1353c HTH-type transcriptional regulator 545 545 ctx cooccurence:543
Rv2079 hyp hypothetical protein 534 534 ctx cooccurence:531
Rv1171 hyp hypothetical protein 534 534 ctx cooccurence:533
Rv3831 hyp hypothetical protein 531 531 ctx neighborhood:526
Rv1346 mbtN acyl-[acyl-carrier-protein 495 496 ctx cooccurence:486
Rv1834 lipZ hydrolase 495 496 ctx cooccurence:478

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: dehydrogenase
  • MTBC0 PGAP product: NAD(P)/FAD-dependent oxidoreductase
  • Pfam (hmmscan --cut_ga): NAD_binding_8 PF13450.13 (E=3e-09), Amino_oxidase PF01593.31 (E=2e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218346.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NAD_binding_8 (PF13450.13), Amino_oxidase (PF01593.31)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1233
  • Curated reference: UniProt O07794 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s); context anchor Rv3830c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004058|Rv3829c|
MTGYDAIVIGAGHNGLTAAVLLQRAGLRTACLDAKRYAGGMASTVELFDGYRFEIAGSVQFPTSSAVSSELGLDSLPTVDLEVMSVALRGVGDDPVVQFTDPTKMLTHLHRVHGADAVTGMAGLLAWSQAPTRALGRFEAGTLPKSFDEMYACATNEFERSAIDDMLFGSVTDVLDRHFPDREKHGALRGSMTVLAVNTLYRGPATPGSAAALAFGLGVPEGDFVRWKKLRGGIGALTTHLSQLLERTGGEVRLRSKVTEIVVDNSRSSARVRGVRTAAGDTLTSPIVVSAIAPDVTINELIDPAVLPSEIRDRYLRIDHRGSYLQMHFALAQPPAFAAPYQALNDPSMQASMGIFCTPEQVQQQWEDCRRGIVPADPTVVLQIPSLHDPSLAPAGKQAASAFAMWFPIEGGSKYGGYGRAKVEMGQNVIDKITRLAPNFKGSILRYTTFTPKHMGVMFGAPGGDYCHALLHSDQIGPNRPGPKGFIGQPIPIAGLYLGSAGCHGGPGITFIPGYNAARQALADRRAANCCVLSGR