Rv1158c Still unknown · low auto-curated

H37Rv Rv1158c · MTBC0 mtbc0_001246 · 227 aa · 1292620–1293303 (-) · RefSeq NP_215674.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06556 TrEMBL · unreviewed · Predicted
UniProt nameConserved hypothetical ala-, pro-rich protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2ARNM

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.651 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pimE (polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase), high confidence from genomic context alone (score 832 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1157c hyp hypothetical protein 990 973 ctx neighborhood:817 coexpression:858 textmining:655
Rv2783c gpsI bifunctional guanosine pentaphosphate synthetase/polyribonucleotide nucleotidyltransferase 861 843 experimental:826
Rv1159 pimE polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase 831 832 ctx neighborhood:776
Rv3810 pirG cell surface protein 831 824 coexpression:772
Rv1023 eno enolase 804 778 experimental:773
Rv1566c ripD hyp hypothetical protein 882 751 coexpression:751 textmining:548
Rv0040c mtc28 hyp hypothetical protein 748 748 coexpression:748
Rv2525c hyp hypothetical protein 732 732 coexpression:732
Rv1421 rapZ hyp hypothetical protein 695 663 experimental:652
Rv1753c PPE24 PPE family protein PPE24 653 653 ctx cooccurence:648
Rv2507 hyp hypothetical protein 648 648 ctx cooccurence:644
Rv2633c hyp hypothetical protein 639 640 ctx cooccurence:635
Rv1918c PPE35 PPE family protein PPE35 634 635 ctx cooccurence:633
Rv3786c hyp hypothetical protein 655 633 ctx cooccurence:572
Rv1004c membrane protein 653 623 ctx cooccurence:577

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215674.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2ARNM
  • Curated reference: UniProt O06556 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 80.4, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 79 functional partner(s); context anchor pimE
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001246|Rv1158c|
MPTIWTFVRAAAVLVGSSAALLTGGIAHADPAPAPAPAPNIPQQLISSAANAPQILQNLATALGATPPLSAPKVAEPAPAAPGITATFPGLTPAAPAAAAAPALTPSIPGVNAPIPGITPAAPALPVTAPAAAPTIPGVNAPIPGITAPAPAAAAVPASVPGVPSAKVDLPQLPYLPLQVPQQLSLPADLPALASGVIPAAPIAPTPPAPGAPALPPGPPSLLAALP