dut Resolved · high auto-curated

H37Rv Rv2697c · MTBC0 - · 154 aa · 3013683–3014147 H37Rv (-) · RefSeq NP_217213.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)deoxyuridine 5'-triphosphate nucleotidohydrolase
MTBC0 PGAP re-annotation
Revised (this work)Deoxyuridine 5'-triphosphate nucleotidohydrolase. Pfam: dUTPase (PF00692.25), DCD (PF22769.2).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

In the literature (TB corpus sweep) 9 publications

9 TB publications mention this gene. 9 publication(s) discuss this gene (7 in a M. tuberculosis context, 1 in other mycobacteria — ).

Most recent 5 of 9.
PublicationDate
dUTPase modulates mycobacterial homologous recombination and interacts with the AdnAB helicase-nuclease. doi:10.1093/nar/gkag660 2026
The Bacteriophage-Phage-Inducible Chromosomal Island Arms Race Designs an Interkingdom Inhibitor of dUTPases. doi:10.1128/spectrum.03232-22 2023
Knowledge of multidrug-resistant tuberculosis amongst Durban University of Technology students in KwaZulu-Natal, South Africa: the need for integrating public health education. doi:10.4314/ahs.v22i2.21 2022
Mycobacterium avium subsp. paratuberculosis Proteome Changes Profoundly in Milk. doi:10.3390/metabo11080549 2021
EspM Is a Conserved Transcription Factor That Regulates Gene Expression in Response to the ESX-1 System. doi:10.1128/mBio.02807-19 2020

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Intrinsic disorder (sequence + structure) partially disordered

Predicted disorder16% of residues (metapredict) · mean AlphaFold pLDDT 98.1
Disordered regions1 IDR(s), longest 24 aa [130-154]

carries a substantial disordered region (24/154 residues); disorder is a property, not a function

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

CRISPRi vulnerability

Vulnerability index -4.28 (95% CI -8.21 to 0.25). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in biosynthesis of thymidylate. This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA [catalytic activity: dUTP + H(2)O = dUMP + pyrophosphate].
Mycobrowser EC 3.6.1.23 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2716c · 99.4% identity
M. leprae ML1028 · 90.9% identity
M. marinum MMAR_2017 · 91.6% identity
M. smegmatis MSMEG_2765 · 84.4% identity
M. orygis RJtmp_002781 · 99.4% identity
M. abscessus MAB_3003c · 81.3% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WNS5 SwissProt · reviewed · Evidence at protein level
UniProt nameDeoxyuridine 5'-triphosphate nucleotidohydrolase
EC (curated) EC 3.6.1.23
Curated functionThis enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namedut
eggNOG descriptionThis enzyme is involved in nucleotide metabolism it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA
Orthologous groupCOG0756
EC number EC 3.6.1.23
KEGG orthology K01520
KEGG pathways map00240, map00983, map01100
KEGG modules M00053
Gene Ontology (100) GO:0000287, GO:0003674, GO:0003824, GO:0004170, GO:0005488, GO:0006139, GO:0006220, GO:0006221, GO:0006226, GO:0006244, GO:0006725, GO:0006753 +88 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.389 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 90.6% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 62.8%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 5 in the ORF — 0 in the essential state, 0 growth-defect, 5 non-essential, 0 growth-advantage. Saturation 0.600, mean read count 2. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 5 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 5 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 15 of 16 independent MS datasets
Integrated abundance309.0 ppm · rank 629/3519 (82.2th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length154 aa
Molecular weight15.8 kDa
Theoretical pI5.66
GRAVY0.212 (hydrophobic)
Aliphatic index110.1
Aromaticity0.026
Instability index30.0 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
dUTPasePF00692.25 8.9e-2715–149 dUTPase
DCDPF22769.2 2.4e-1332–118 dCTP deaminase-like

Experimental structures (Protein Data Bank) 18 solved

PDBMethodResolutionCoverage
3hza X-ray diffraction 1.2 Å 100%
3loj X-ray diffraction 1.25 Å 100%
1six X-ray diffraction 1.3 Å 100%
2py4 X-ray diffraction 1.49 Å 100%
4gcy X-ray diffraction 1.5 Å 100%
1sjn X-ray diffraction 1.8 Å 100%
3h6d X-ray diffraction 1.8 Å 100%
1snf X-ray diffraction 1.85 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (18 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 98.1

PDB hitprobTM-scoreE-valueDescription
3loj-assembly1_A 1.00 1.00 5.7e-28 sig 3loj-assembly1_A Structure of Mycobacterium tuberculosis dUTPase H145A mutant
4gcy-assembly1_A 1.00 1.00 6.1e-28 sig 4gcy-assembly1_A Structure of Mycobacterium tuberculosis dUTPase H21W mutant
3hza-assembly1_A 1.00 1.00 1.7e-27 sig 3hza-assembly1_A Crystal structure of dUTPase H145W mutant
2py4-assembly1_A 1.00 1.00 1.8e-27 sig 2py4-assembly1_A Full length structure of the Mycobacterium tuberculosis dUTPase complexed with magnesium and alpha,beta-imido-dUTP.
1six-assembly1_A 1.00 0.99 6.8e-26 sig 1six-assembly1_A Mycobacterium tuberculosis dUTPase complexed with magnesium and alpha,beta-imido-dUTP

Foldseek search of the AlphaFold DB model (mean pLDDT 98.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv2696c (- strand, 74 bp gap)
Downstream (3' on genome)Rv2698 (+ strand, 25 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2698 (transmembrane protein), high confidence from genomic context alone (score 793 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1252c lprE exp lipoprotein LprE 964 963 experimental:837 database:782
Rv2764c thyA exp thymidylate synthase ThyA 986 951 coexpression:445 database:900 textmining:739
Rv3247c tmk exp thymidylate kinase 949 929 database:900
Rv2445c ndkA exp nucleoside diphosphate kinase 956 914 database:900 textmining:513
Rv2754c thyX exp thymidylate synthase ThyX 993 908 database:900 textmining:934
Rv0321 dcd exp deoxycytidine triphosphate deaminase 930 908 database:900
Rv2698 transmembrane protein 793 793 ctx neighborhood:790
Rv2696c hyp hypothetical protein 793 793 ctx neighborhood:790
Rv2116 lppK lipoprotein LppK 743 718 coexpression:709
Rv0002 dnaN DNA polymerase III subunit beta 743 718 coexpression:709
Rv2737c recA exp recombinase A 792 707 coexpression:414 database:457
Rv1391 dfp bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase 716 699 coexpression:674
Rv0252 nirB nitrite reductase large subunit NirB 685 673 ctx fusion:673
Rv3051c nrdE ribonucleoside-diphosphate reductase subunit alpha 703 663 coexpression:644
Rv0570 nrdZ vitamin B12-dependent ribonucleoside-diphosphate reductase 703 663 coexpression:644

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): deoxyuridine 5'-triphosphate nucleotidohydrolase
  • Pfam (hmmscan --cut_ga): dUTPase PF00692.25 (E=9e-27), DCD PF22769.2 (E=2e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217213.1)
  • Domains: Pfam-A via hmmscan --cut_ga — dUTPase (PF00692.25), DCD (PF22769.2)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0756
  • Curated reference: UniProt P9WNS5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 98.1)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 37 functional partner(s); context anchor Rv2698
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2697c|dut
MSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVELVELVEVSSFDEAGLASTSRGDGGHGSSGGHASL