Rv0948c Resolved · high auto-curated

H37Rv Rv0948c · MTBC0 mtbc0_001012 · 105 aa · 1064861–1065178 (-) · RefSeq NP_215463.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)chorismate mutase
MTBC0 PGAP re-annotationchorismate mutase
Revised (this work)Chorismate mutase. Pfam: CM_2 (PF01817.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIC1 SwissProt · reviewed · Evidence at protein level
UniProt nameIntracellular chorismate mutase
EC (curated) EC 5.4.99.5
Curated functionCatalyzes the Claisen rearrangement of chorismate to prephenate. Probably involved in the aromatic amino acid biosynthesis.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namecsm
eggNOG descriptionchorismate mutase
Orthologous groupCOG1605
EC number EC 5.4.99.5
KEGG orthology K04093
KEGG pathways map00400, map01100, map01110, map01130, map01230
KEGG modules M00024, M00025
Gene Ontology (41) GO:0003674, GO:0003824, GO:0004106, GO:0005575, GO:0005623, GO:0005886, GO:0006082, GO:0006520, GO:0006725, GO:0006807, GO:0008150, GO:0008152 +29 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.331 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CM_2PF01817.27 2.6e-1232–88 Chorismate mutase type II

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2179c (3'-5' exoribonuclease), high confidence from genomic context alone (score 774 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2178c aroG phospho-2-dehydro-3-deoxyheptonate aldolase AroG 999 999 experimental:999 textmining:823
Rv2540c aroF chorismate synthase 975 965 coexpression:644 database:900
Rv3754 tyrA prephenate dehydrogenase TyrA 962 947 database:900
Rv3838c pheA prephenate dehydratase 940 909 database:900
Rv1609 trpE anthranilate synthase component I 981 906 database:900 textmining:815
Rv1885c chorismate mutase 979 901 database:900 textmining:803
Rv3215 entC isochorismate synthase 887 870 database:800
Rv0013 trpG anthranilate synthase component II 928 814 database:800 textmining:629
Rv2386c mbtI salicylate synthase 836 811 database:800
Rv1005c pabB para-aminobenzoate synthase component I 822 811 database:800
Rv2949c chorismate pyruvate-lyase 821 810 database:800
Rv2179c 3'-5' exoribonuclease 773 774 ctx cooccurence:773
Rv2744c 35kd_ag hyp hypothetical protein 770 770 ctx cooccurence:768
Rv3311 hyp hypothetical protein 742 742 ctx cooccurence:738
Rv1209 hyp hypothetical protein 730 730 ctx cooccurence:729

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: chorismate mutase
  • MTBC0 PGAP product: chorismate mutase
  • Pfam (hmmscan --cut_ga): CM_2 PF01817.27 (E=3e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215463.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CM_2 (PF01817.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1605
  • Curated reference: UniProt P9WIC1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 111 functional partner(s); context anchor Rv2179c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001012|Rv0948c|
MRPEPPHHENAELAAMNLEMLESQPVPEIDTLREEIDRLDAEILALVKRRAEVSKAIGKARMASGGTRLVHSREMKVIERYSELGPDGKDLAILLLRLGRGRLGH