Rv0500A Family assigned · medium auto-curated
H37Rv Rv0500A · MTBC0 - ·
78 aa · 591111–591347 (+) ·
RefSeq YP_177624.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | DNA-binding protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | DNA-binding protein. Pfam: HTH_17 (PF12728.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WKT7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative DNA-binding protein Rv0500A |
UniProt still lists this protein as Putative DNA-binding protein Rv0500A; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| Preferred name | xis |
| eggNOG description | DNA binding domain, excisionase family |
| Orthologous group | COG3311 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
HTH_17 | PF12728.14 | 1.4e-15 | 24–72 | Helix-turn-helix domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: proC (pyrroline-5-carboxylate reductase), high confidence from genomic context alone (score 744 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0500 proC |
pyrroline-5-carboxylate reductase | 744 | 744 ctx | neighborhood:742 |
Rv0498 hyp |
hypothetical protein | 740 | 740 ctx | neighborhood:724 |
Rv0496 ppx1 hyp |
hypothetical protein | 717 | 717 ctx | neighborhood:715 |
Rv0500B |
Rv0500B, len: 33 aa. Conserved hypothetical protein. Basic protein 18 of the 33 aa are Arg or Lys, with strong similarity to AL079345|SCE68_ | 578 | 578 ctx | neighborhood:559 |
Rv0499 hyp |
hypothetical protein | 565 | 565 ctx | neighborhood:562 |
Rv0497 |
transmembrane protein | 561 | 561 ctx | neighborhood:557 |
Rv1087A |
Rv1087A, len: 106 aa (fragment). Conserved hypothetical protein, highly similar to C-terminus of near ORF O53434|YA86_MYCTU|Rv1086|MT1118|MT | 545 | 545 ctx | cooccurence:545 |
Rv0495c hyp |
hypothetical protein | 512 | 512 ctx | neighborhood:430 |
Rv0501 galE2 |
UDP-glucose 4-epimerase GalE | 476 | 477 ctx | neighborhood:463 |
Rv0502 hyp |
hypothetical protein | 452 | 452 ctx | neighborhood:447 |
Rv2413c hyp |
hypothetical protein | 423 | 424 ctx | cooccurence:420 |
Rv2745c clgR |
transcriptional regulator ClgR | 436 | 415 | |
Rv2657c |
prophage protein | 521 | 47 | textmining:518 |
Rv0842 |
integral membrane protein | 657 | 45 | textmining:656 |
Rv1584c |
phage protein | 870 | 41 | textmining:870 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): DNA-binding protein
- Pfam (hmmscan --cut_ga): HTH_17 PF12728.14 (E=1e-15)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177624.1)
- Domains: Pfam-A via hmmscan --cut_ga — HTH_17 (PF12728.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3311 - Curated reference: UniProt P9WKT7 (SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
16 functional partner(s); context anchor
proC - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0500A| MTSTNGPSARDTGFVEGQQAKTQLLTVAEVAALMRVSKMTVYRLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDAG