Rv0500A Family assigned · medium auto-curated

H37Rv Rv0500A · MTBC0 - · 78 aa · 591111–591347 (+) · RefSeq YP_177624.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)DNA-binding protein
MTBC0 PGAP re-annotation
Revised (this work)DNA-binding protein. Pfam: HTH_17 (PF12728.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WKT7 SwissProt · reviewed · Evidence at protein level
UniProt namePutative DNA-binding protein Rv0500A

UniProt still lists this protein as Putative DNA-binding protein Rv0500A; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namexis
eggNOG descriptionDNA binding domain, excisionase family
Orthologous groupCOG3311

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_17PF12728.14 1.4e-1524–72 Helix-turn-helix domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: proC (pyrroline-5-carboxylate reductase), high confidence from genomic context alone (score 744 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0500 proC pyrroline-5-carboxylate reductase 744 744 ctx neighborhood:742
Rv0498 hyp hypothetical protein 740 740 ctx neighborhood:724
Rv0496 ppx1 hyp hypothetical protein 717 717 ctx neighborhood:715
Rv0500B Rv0500B, len: 33 aa. Conserved hypothetical protein. Basic protein 18 of the 33 aa are Arg or Lys, with strong similarity to AL079345|SCE68_ 578 578 ctx neighborhood:559
Rv0499 hyp hypothetical protein 565 565 ctx neighborhood:562
Rv0497 transmembrane protein 561 561 ctx neighborhood:557
Rv1087A Rv1087A, len: 106 aa (fragment). Conserved hypothetical protein, highly similar to C-terminus of near ORF O53434|YA86_MYCTU|Rv1086|MT1118|MT 545 545 ctx cooccurence:545
Rv0495c hyp hypothetical protein 512 512 ctx neighborhood:430
Rv0501 galE2 UDP-glucose 4-epimerase GalE 476 477 ctx neighborhood:463
Rv0502 hyp hypothetical protein 452 452 ctx neighborhood:447
Rv2413c hyp hypothetical protein 423 424 ctx cooccurence:420
Rv2745c clgR transcriptional regulator ClgR 436 415
Rv2657c prophage protein 521 47 textmining:518
Rv0842 integral membrane protein 657 45 textmining:656
Rv1584c phage protein 870 41 textmining:870

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): DNA-binding protein
  • Pfam (hmmscan --cut_ga): HTH_17 PF12728.14 (E=1e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177624.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_17 (PF12728.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3311
  • Curated reference: UniProt P9WKT7 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor proC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0500A|
MTSTNGPSARDTGFVEGQQAKTQLLTVAEVAALMRVSKMTVYRLVHNGELPAVRVGRSFRVHAKAVHDMLETSYFDAG