Rv2652c Resolved · high auto-curated

H37Rv Rv2652c · MTBC0 - · 208 aa · 2975928–2976554 (-) · RefSeq NP_217168.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)prophage protein
MTBC0 PGAP re-annotation
Revised (this work)Prophage protein. Pfam: Terminase_4 (PF05119.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P71949 TrEMBL · unreviewed · Predicted
UniProt nameProbable PhiRv2 prophage protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionPhage terminase, small subunit
Orthologous groupCOG3747

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.421 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 12 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.16% of strains (230) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Terminase_4PF05119.18 1.4e-2296–188 Phage terminase, small subunit

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2653c (toxin), medium confidence from genomic context alone (score 693 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2653c toxin 693 693 ctx neighborhood:685
Rv2651c prophage protease 636 617 ctx neighborhood:493
Rv2650c prophage protein 602 588 ctx neighborhood:493
Rv2655c prophage protein 513 512 ctx neighborhood:504
Rv2656c prophage protein 499 499 ctx neighborhood:496
Rv2654c antitoxin 497 496 ctx neighborhood:493
Rv2657c prophage protein 495 495 ctx neighborhood:493
Rv2658c prophage protein 476 476 ctx neighborhood:473
Rv2659c prophage integrase 485 475 ctx neighborhood:472
Rv1378c hyp hypothetical protein 401 401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): prophage protein
  • Pfam (hmmscan --cut_ga): Terminase_4 PF05119.18 (E=1e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217168.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Terminase_4 (PF05119.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3747
  • Curated reference: UniProt P71949 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor Rv2653c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2652c|
MPSPATARPDTATVGERVRAQVLWGVFWHHGIRDPKPGKRRVVLKMGRRGPAPAPAQLKLLGGRSPGRDSGGRRVTPPAAFERVAPECPDWLPPGAKDMWGRVVPELAALNLLKESDLGVLTSFCVAWDQLMQAVTAYREQGFIATNARSRRVTVHPAVAAARAATRDVLVLARELGCTPSAEANLAAVLAAAGDPDDDEFNPFAPDR