vapB10 Family assigned · medium auto-curated

H37Rv Rv1398c · MTBC0 mtbc0_001499 · 85 aa · 1583854–1584111 (-) · RefSeq NP_215914.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB10
MTBC0 PGAP re-annotationCopG family transcriptional regulator
Revised (this work)CopG family transcriptional regulator. Pfam: RHH_5 (PF07878.18), RHH_1 (PF01402.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLZ1 SwissProt · reviewed · Evidence at protein level
UniProt namePutative antitoxin VapB10
Curated functionPutative antitoxin component of a possible type II toxin-antitoxin (TA) system. The cognate toxin is VapC10.

UniProt still lists this protein as Putative antitoxin VapB10; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionCopG-like RHH_1 or ribbon-helix-helix domain, RHH_5
Orthologous group2EQ3X
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RHH_5PF07878.18 8.2e-071–42 CopG-like RHH_1 or ribbon-helix-helix domain, RHH_5
RHH_1PF01402.28 1.5e-112–40 Ribbon-helix-helix protein, copG family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC10 (ribonuclease VapC10), high confidence from genomic context alone (score 889 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1397c vapC10 ribonuclease VapC10 889 889 ctx neighborhood:882
Rv3583c carD RNA polymerase-binding transcription factor CarD 740 740 coexpression:740
Rv1399c nlhH carboxylesterase NlhH 604 604 ctx neighborhood:604
Rv1400c lipI lipase 544 544 ctx neighborhood:543
Rv1396c PE_PGRS25 PE-PGRS family protein PE_PGRS25 452 452 ctx neighborhood:452
Rv3461c rpmJ 50S ribosomal protein L36 443 55 textmining:435
Rv2656c prophage protein 521 51 textmining:516
Rv0581 vapB26 antitoxin VapB26 514 49 textmining:510
Rv2355 Probable transposase; Rv2355, (MTCY98.24), len: 328 aa. Probable IS6110 transposase. Identical to many other M. tuberculosis IS6110 transpos 630 47 textmining:628
Rv0718 rpsH 30S ribosomal protein S8 518 47 textmining:515
Rv2657c prophage protein 435 46 textmining:433
Rv1114 vapC32 ribonuclease VapC32 415 44 textmining:414
Rv2278 Rv2278, (MTCY339.32c), len: 108 aa. Putative Transposase for IS6110 (fragment). Identical to many other M. tuberculosis IS6110 transposase s 628 41 textmining:628
Rv0661c vapC7 ribonuclease VapC7 603 41 textmining:603
Rv0550c vapB3 antitoxin VapB3 515 41 textmining:515

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin VapB10
  • MTBC0 PGAP product: CopG family transcriptional regulator
  • Pfam (hmmscan --cut_ga): RHH_5 PF07878.18 (E=8e-07), RHH_1 PF01402.28 (E=1e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215914.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RHH_5 (PF07878.18), RHH_1 (PF01402.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EQ3X
  • Curated reference: UniProt P9WLZ1 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor vapC10
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001499|Rv1398c|vapB10
MKRTNIYLDEEQTASLDKLAAQEGVSRAELIRLLLNRALTTAGDDLASDLQAINDSFGTLRHLDPPVRRSGGREQHLAQVWRATS