arsC Family assigned · medium auto-curated

H37Rv Rv2643 · MTBC0 mtbc0_002813 · 498 aa · 2990471–2991967 MTBC0 (+) · RefSeq NP_217159.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv2629 (Rv2629) — family_assigned: hypothetical protein Rv2629 Rv2630 (Rv2630) — requalified: archease Rv2632c (Rv2632c) — family_assigned: DUF1876 domain-containing protein Rv2633c (Rv2633c) — requalified: non-heme di-iron catalase Rv2635 (Rv2635) — requalified: hypothetical protein Rv2636 (Rv2636) — family_assigned: chloramphenicol phosphotransferase CPT family protein dedA (Rv2637) — family_assigned: DedA family protein Rv2638 (Rv2638) — requalified: anti-sigma factor antagonist Rv2639c (Rv2639c) — family_assigned: YnfA family protein Rv2640c (Rv2640c) — family_assigned: Rv2640c family ArsR-like transcriptional regulator cadI (Rv2641) — requalified: cadmium-induced metalloenzyme CadI Rv2642 (Rv2642) — family_assigned: metalloregulator ArsR/SmtB family transcription factor arsC (Rv2643) — family_assigned: ACR3 family arsenite efflux transporter arsC Rv2645 (Rv2645) — family_assigned: hypothetical protein Rv2646 (Rv2646) — requalified: tyrosine-type recombinase/integrase Rv2646 Rv2650c (Rv2650c) — requalified: phage major capsid protein Rv2650c Rv2651c (Rv2651c) — family_assigned: HK97 family phage prohead protease Rv2653c (Rv2653c) — requalified: type II toxin-antitoxin system toxin Rv2654c (Rv2654c) — requalified: type II toxin-antitoxin system antitoxin Rv2655c (Rv2655c) — family_assigned: DUF3631 domain-containing protein Rv2655c Rv2656c (Rv2656c) — dark: DUF2742 domain-containing protein Rv2657c (Rv2657c) — family_assigned: helix-turn-helix domain-containing protein Rv2658c (Rv2658c) — family_assigned: hypothetical protein Rv2659c (Rv2659c) — requalified: tyrosine-type recombinase/integrase Rv2659c Rv2660c (Rv2660c) — dark: hypothetical protein 2 980 kb 2 984 kb 2 988 kb 2 992 kb 2 996 kb 3 000 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)arsenic-transport integral membrane protein ArsC
MTBC0 PGAP re-annotationACR3 family arsenite efflux transporter
Revised (this work)ACR3 family arsenite efflux transporter. Pfam: SBF (PF01758.22), LMWPc (PF01451.28).
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 5 publications

5 TB publications mention this gene. 5 publication(s) discuss this gene (4 in a M. tuberculosis context).

PublicationDate
Novel Photoelectron-Assisted Microbial Reduction of Arsenate Driven by Photosensitive Dissolved Organic Matter in Mine Stream Sediments. doi:10.1021/acs.est.4c09647 2024
Identification of Mutations Associated With Macozinone-Resistant in Mycobacterium Tuberculosis. doi:10.1007/s00284-022-02881-x 2022
A systemic approach to explore the mechanisms of drug resistance and altered signaling cascades in extensively drug-resistant tuberculosis. doi:10.1016/bs.apcsb.2021.02.002 2021
Cd(II)-binding transcriptional regulator interacts with isoniazid and regulates drug susceptibility in mycobacteria. doi:10.1093/jb/mvaa086 2021
Novel channel enzyme fusion proteins confer arsenate resistance. doi:10.1074/jbc.M110.184457 2010

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene

NeighbourRv2642 (Rv2642, + strand)
Overlap4 bp, 0 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): HPT-2b Induced.

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in transport of arsenic compounds across the membrane (export): arsenic resistance by an export mechanism. Responsible for the translocation of the substrate across the membrane.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2676 · 99.8% identity
M. marinum MMAR_2055 · 88.0% identity
M. smegmatis MSMEG_1172 · 89.1% identity
M. orygis RJtmp_002737 · 100.0% identity
M. abscessus MAB_4863 · 87.4% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt I6X4W4 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable arsenic-transport integral membrane protein ArsC

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namearsB
eggNOG descriptionarsenical-resistance protein
Orthologous groupCOG0394
EC number EC 1.20.4.1
KEGG orthology K03325, K03741

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.495 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 8 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.65% of strains (951) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.374 (low power) · 2 consensus substitution(s)
low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 47/53 (89%) · mean identity 83.5% · 4/4 closest MTBAP relatives
conserved across the genus (present in 47/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 9/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 74.1%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 31 in the ORF — 0 in the essential state, 0 growth-defect, 31 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 122.838709677. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 7 of 16 independent MS datasets
Integrated abundance3.37 ppm · rank 3064/3519 (13.0th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox)

Predictionpredicted membrane protein (10 TM helixes)
DeepTMHMM classTM
TM helices (DeepTMHMM)10

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length498 aa
Molecular weight53.2 kDa
Theoretical pI8.74
GRAVY0.583 (hydrophobic)
Aliphatic index121.9
Aromaticity0.08
Instability index28.6 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SBFPF01758.22 1.1e-6062–258 Sodium Bile acid symporter family
LMWPcPF01451.28 6.6e-15366–491 Low molecular weight phosphotyrosine protein phosphatase

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 83.8

PDB hitprobTM-scoreE-valueDescription
4n7w-assembly1_A 1.00 0.82 2.1e-09 sig 4n7w-assembly1_A Crystal Structure of the sodium bile acid symporter from Yersinia frederiksenii
7cyg-assembly2_B 1.00 0.85 4.9e-09 sig 7cyg-assembly2_B Crystal structure of a cysteine-pair mutant (Y113C-P190C) of a bacterial bile acid transporter before disulfide bond formation
7cyk-assembly2_B 1.00 0.84 7.3e-09 sig 7cyk-assembly2_B Crystal structure of a second cysteine-pair mutant (V110C-I197C) of a bacterial bile acid transporter before disulfide bond formation
3t38-assembly1_A 1.00 0.81 2.7e-08 sig 3t38-assembly1_A Corynebacterium glutamicum thioredoxin-dependent arsenate reductase Cg_ArsC1'
2cd7-assembly1_A 1.00 0.90 3.6e-07 sig 2cd7-assembly1_A Staphylococcus aureus pI258 arsenate reductase (ArsC) H62Q mutant

Foldseek search of the AlphaFold DB model (mean pLDDT 83.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv2642 (+ strand, -4 bp gap)
Downstream (3' on genome)Rv2644c (- strand, 126 bp gap)
Predicted operon Rv2642 · arsC

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) Rv0081 (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2642 (ArsR family transcriptional regulator), high confidence from genomic context alone (score 940 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2642 ArsR family transcriptional regulator 954 940 ctx neighborhood:882
Rv2641 cadI cadmium inducible protein CadI 965 817 ctx neighborhood:756 textmining:820
Rv2640c ArsR family transcriptional regulator 851 802 ctx neighborhood:687
Rv0324 transcriptional regulator 805 729 ctx neighborhood:479
Rv1674c transcriptional regulator 804 728 ctx neighborhood:479
Rv2874 dipZ integral membrane C-type cytochrome biogenesis protein DipZ 772 554 ctx neighborhood:544 textmining:510
Rv1471 trxB1 exp thioredoxin 657 542 experimental:438
Rv3914 trxC exp thioredoxin TrxC 647 529 experimental:438
Rv1470 trxA exp thioredoxin TrxA 645 526 experimental:438
Rv1324 exp thioredoxin 643 523 experimental:438
Rv2940c mas multifunctional mycocerosic acid synthase 585 523
Rv1527c pks5 polyketide synthase 585 523
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 584 522
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 584 522
Rv2048c pks12 polyketide synthase 584 522

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: arsenic-transport integral membrane protein ArsC
  • MTBC0 PGAP product: ACR3 family arsenite efflux transporter
  • Pfam (hmmscan --cut_ga): SBF PF01758.22 (E=1e-60), LMWPc PF01451.28 (E=7e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217159.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SBF (PF01758.22), LMWPc (PF01451.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0394
  • Curated reference: UniProt I6X4W4 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 83.8)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 81 functional partner(s); context anchor Rv2642
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002813|Rv2643|arsC
MTETVTRTAAPAVVGKLSTLDRFLPVWIGSAMAAGLLLGRWIPGLHTALEGVQLDGISLPIALGLLIMMYPVLAKVRYDRLDTVTGDRKLLLSSLLLNWVLGPALMFALAWLLLADLPEYRTGLIIVGLARCIAMVIIWNDLACGDREAAAVLVALNSIFQVAMFAALGWFYLSVLPGWLGLEQTTIATSPWQIAKSVLIFLGIPLLAGYLSRRIGEKTKGRNWYESRFLPKVGPWALYGLLFTIVILFALQGDQITGRPLDVARIALPLLAYFAIMWVGGYLLGAALRLGYRRTTTLAFTAASNNFELAIAVAIATYGATSGQALAGVVGPLIEVPVLVGLVYVSLALRNRLAGPNATHDADKPSVLFVCVHNAGRSQMAAGLLTHLAGDRIEVRSAGTEPAGQVNPTAVAAMAEMGIDITANAPTLLTGGQVQSSDVVITMGCGDACPYFPGVSYRNWKLPDPAGQPLDVVRMIRDDIADRVQALIAELLATAKTR