arsC Family assigned · medium auto-curated

H37Rv Rv2643 · MTBC0 mtbc0_002813 · 498 aa · 2990471–2991967 (+) · RefSeq NP_217159.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)arsenic-transport integral membrane protein ArsC
MTBC0 PGAP re-annotationACR3 family arsenite efflux transporter
Revised (this work)ACR3 family arsenite efflux transporter. Pfam: SBF (PF01758.22), LMWPc (PF01451.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6X4W4 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable arsenic-transport integral membrane protein ArsC

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namearsB
eggNOG descriptionarsenical-resistance protein
Orthologous groupCOG0394
EC number EC 1.20.4.1
KEGG orthology K03325, K03741

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.495 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 8 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 0.65% of strains (951) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SBFPF01758.22 1.1e-6062–258 Sodium Bile acid symporter family
LMWPcPF01451.28 6.6e-15366–491 Low molecular weight phosphotyrosine protein phosphatase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2642 (ArsR family transcriptional regulator), high confidence from genomic context alone (score 940 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2642 ArsR family transcriptional regulator 954 940 ctx neighborhood:882
Rv2641 cadI cadmium inducible protein CadI 965 817 ctx neighborhood:756 textmining:820
Rv2640c ArsR family transcriptional regulator 851 802 ctx neighborhood:687
Rv0324 transcriptional regulator 805 729 ctx neighborhood:479
Rv1674c transcriptional regulator 804 728 ctx neighborhood:479
Rv2874 dipZ integral membrane C-type cytochrome biogenesis protein DipZ 772 554 ctx neighborhood:544 textmining:510
Rv1471 trxB1 thioredoxin 657 542 experimental:438
Rv3914 trxC thioredoxin TrxC 647 529 experimental:438
Rv1470 trxA thioredoxin TrxA 645 526 experimental:438
Rv1324 thioredoxin 643 523 experimental:438
Rv2940c mas multifunctional mycocerosic acid synthase 585 523
Rv1527c pks5 polyketide synthase 585 523
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 584 522
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 584 522
Rv2048c pks12 polyketide synthase 584 522

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: arsenic-transport integral membrane protein ArsC
  • MTBC0 PGAP product: ACR3 family arsenite efflux transporter
  • Pfam (hmmscan --cut_ga): SBF PF01758.22 (E=1e-60), LMWPc PF01451.28 (E=7e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217159.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SBF (PF01758.22), LMWPc (PF01451.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0394
  • Curated reference: UniProt I6X4W4 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 81 functional partner(s); context anchor Rv2642
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002813|Rv2643|arsC
MTETVTRTAAPAVVGKLSTLDRFLPVWIGSAMAAGLLLGRWIPGLHTALEGVQLDGISLPIALGLLIMMYPVLAKVRYDRLDTVTGDRKLLLSSLLLNWVLGPALMFALAWLLLADLPEYRTGLIIVGLARCIAMVIIWNDLACGDREAAAVLVALNSIFQVAMFAALGWFYLSVLPGWLGLEQTTIATSPWQIAKSVLIFLGIPLLAGYLSRRIGEKTKGRNWYESRFLPKVGPWALYGLLFTIVILFALQGDQITGRPLDVARIALPLLAYFAIMWVGGYLLGAALRLGYRRTTTLAFTAASNNFELAIAVAIATYGATSGQALAGVVGPLIEVPVLVGLVYVSLALRNRLAGPNATHDADKPSVLFVCVHNAGRSQMAAGLLTHLAGDRIEVRSAGTEPAGQVNPTAVAAMAEMGIDITANAPTLLTGGQVQSSDVVITMGCGDACPYFPGVSYRNWKLPDPAGQPLDVVRMIRDDIADRVQALIAELLATAKTR