Rv2642 Family assigned · medium auto-curated

H37Rv Rv2642 · MTBC0 mtbc0_002812 · 126 aa · 2990094–2990474 MTBC0 (+) · RefSeq NP_217158.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv2627c (Rv2627c) — family_assigned: alpha/beta hydrolase Rv2629 (Rv2629) — family_assigned: hypothetical protein Rv2629 Rv2630 (Rv2630) — requalified: archease Rv2632c (Rv2632c) — family_assigned: DUF1876 domain-containing protein Rv2633c (Rv2633c) — requalified: non-heme di-iron catalase Rv2635 (Rv2635) — requalified: hypothetical protein Rv2636 (Rv2636) — family_assigned: chloramphenicol phosphotransferase CPT family protein dedA (Rv2637) — family_assigned: DedA family protein Rv2638 (Rv2638) — requalified: anti-sigma factor antagonist Rv2639c (Rv2639c) — family_assigned: YnfA family protein Rv2640c (Rv2640c) — family_assigned: Rv2640c family ArsR-like transcriptional regulator cadI (Rv2641) — requalified: cadmium-induced metalloenzyme CadI Rv2642 (Rv2642) — family_assigned: metalloregulator ArsR/SmtB family transcription factor arsC (Rv2643) — family_assigned: ACR3 family arsenite efflux transporter arsC Rv2645 (Rv2645) — family_assigned: hypothetical protein Rv2646 (Rv2646) — requalified: tyrosine-type recombinase/integrase Rv2646 Rv2650c (Rv2650c) — requalified: phage major capsid protein Rv2650c Rv2651c (Rv2651c) — family_assigned: HK97 family phage prohead protease Rv2653c (Rv2653c) — requalified: type II toxin-antitoxin system toxin Rv2654c (Rv2654c) — requalified: type II toxin-antitoxin system antitoxin Rv2655c (Rv2655c) — family_assigned: DUF3631 domain-containing protein Rv2655c Rv2656c (Rv2656c) — dark: DUF2742 domain-containing protein Rv2657c (Rv2657c) — family_assigned: helix-turn-helix domain-containing protein Rv2658c (Rv2658c) — family_assigned: hypothetical protein Rv2659c (Rv2659c) — requalified: tyrosine-type recombinase/integrase 2 980 kb 2 984 kb 2 988 kb 2 992 kb 2 996 kb 3 000 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ArsR family transcriptional regulator
MTBC0 PGAP re-annotationmetalloregulator ArsR/SmtB family transcription factor
Revised (this work)Metalloregulator ArsR/SmtB family transcription factor. Pfam: HTH_20 (PF12840.14), HTH_5 (PF01022.27).
Functional category (TubercuList)regulatory proteins

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 3 publications

3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context).

PublicationDate
Construction and immunogenicity evaluation of a tuberculosis subunit vaccine based on fusion protein AP2 and novel adjuvant ASM. doi:10.1007/s00203-026-04975-7 2026
Cd(II)-binding transcriptional regulator interacts with isoniazid and regulates drug susceptibility in mycobacteria. doi:10.1093/jb/mvaa086 2021
Characterization of a putative ArsR transcriptional regulator encoded by Rv2642 from Mycobacterium tuberculosis. doi:10.1080/07391102.2016.1206037 2017

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene

NeighbourarsB (Rv2643, + strand)
Overlap4 bp, 1 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): HPT-2b Induced.

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 0.49 (95% CI -0.62 to 2.31). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in transcriptional mechanism.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2675 · 100.0% identity
M. marinum MMAR_2056 · 84.5% identity
M. smegmatis MSMEG_1173 · 69.9% identity
M. orygis RJtmp_002736 · 99.2% identity
M. abscessus MAB_4862 · 67.7% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P71941 TrEMBL · unreviewed · Predicted
UniProt namePossible transcriptional regulatory protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG0640
KEGG orthology K03892

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 50/53 (94%) · mean identity 65.9% · 4/4 closest MTBAP relatives
conserved across the genus (present in 50/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 51.2%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 4 in the ORF — 0 in the essential state, 0 growth-defect, 4 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 108.75. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatStatistically thin call: only 4 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 5 of 16 independent MS datasets
Integrated abundance2.24 ppm · rank 3149/3519 (10.5th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox) lipoprotein

Predictionpredicted lipoprotein (lipobox + signal peptide)
DeepTMHMM classGLOB
Lipoboxsignal-peptidase-II lipobox; lipidated Cys near position 13

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length126 aa
Molecular weight13.1 kDa
Theoretical pI6.89
GRAVY0.383 (hydrophobic)
Aliphatic index111.6
Aromaticity0.032
Instability index58.2 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_20PF12840.14 7.1e-1038–90 Helix-turn-helix domain
HTH_5PF01022.27 1.8e-1740–88 Bacterial regulatory protein, arsR family

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 82.8

PDB hitprobTM-scoreE-valueDescription
7p6f-assembly2_CCC-2 1.00 0.84 2.6e-07 sig 7p6f-assembly2_CCC-2 1.93 A resolution X-ray crystal structure of the transcriptional regulator SrnR from Streptomyces griseus
7p6f-assembly1_BBB 1.00 0.85 1.4e-06 sig 7p6f-assembly1_BBB 1.93 A resolution X-ray crystal structure of the transcriptional regulator SrnR from Streptomyces griseus
3f6o-assembly1_A 1.00 0.85 6.8e-06 sig 3f6o-assembly1_A Crystal structure of ArsR family transcriptional regulator, RHA00566
6j0e-assembly1_A 1.00 0.85 9.9e-06 sig 6j0e-assembly1_A Structures of two ArsR As(III)-responsive repressors: implications for the mechanism of derepression
3f6o-assembly1_B 1.00 0.88 3.1e-05 sig 3f6o-assembly1_B Crystal structure of ArsR family transcriptional regulator, RHA00566

Foldseek search of the AlphaFold DB model (mean pLDDT 82.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)cadI (+ strand, 135 bp gap)
Downstream (3' on genome)arsC (+ strand, -4 bp gap)
Predicted operon Rv2642 · arsC

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE) transcription factor

Regulated by (2 TF) Rv0081 (activates) · Rv1353c (activates)
Regulonthis transcription factor regulates 3 target gene(s)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: arsC (arsenic-transport integral membrane protein ArsC), high confidence from genomic context alone (score 940 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2643 arsC arsenic-transport integral membrane protein ArsC 954 940 ctx neighborhood:882
Rv1674c transcriptional regulator 816 811 coexpression:777
Rv1931c transcriptional regulator 788 788 coexpression:738
Rv0494 HTH-type transcriptional regulator 788 781 coexpression:780
Rv3167c TetR family transcriptional regulator 764 756 coexpression:756
Rv1460 sufR transcriptional regulator 766 754 coexpression:754
Rv2641 cadI cadmium inducible protein CadI 762 753 ctx neighborhood:703
Rv3183 higA3 transcriptional regulator 746 739 coexpression:739
Rv0767c HTH-type transcriptional regulator 743 735 coexpression:735
Rv1985c lysG HTH-type transcriptional regulator 743 733 coexpression:733
Rv1167c transcriptional regulator 666 654 coexpression:654
Rv0653c transcriptional regulator 666 654 coexpression:654
Rv0792c transcriptional regulator 618 615 coexpression:615
Rv2640c ArsR family transcriptional regulator 602 602 ctx neighborhood:532
Rv2358 smtB HTH-type transcriptional regulator SmtB 565 566 ctx cooccurence:564

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ArsR family transcriptional regulator
  • MTBC0 PGAP product: metalloregulator ArsR/SmtB family transcription factor
  • Pfam (hmmscan --cut_ga): HTH_20 PF12840.14 (E=7e-10), HTH_5 PF01022.27 (E=2e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217158.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_20 (PF12840.14), HTH_5 (PF01022.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0640
  • Curated reference: UniProt P71941 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 82.8)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor arsC
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide; (myco)bacterial lipobox (Sutcliffe & Harrington 2004, doi:10.1099/mic.0.26804-0)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002812|Rv2642|
MSNLHPLPEVASCVVAPLVREPLNPPAAAEMAARFKALADPVRLQLLSSVASRAGGEACVCDISAGVEVSQPTISHHLKVLRDAGLLTSRRRASWVYYAVVPEALTVLSNLLSVHADAAPALGAPA