Rv2642 Family assigned · medium auto-curated

H37Rv Rv2642 · MTBC0 mtbc0_002812 · 126 aa · 2990094–2990474 (+) · RefSeq NP_217158.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ArsR family transcriptional regulator
MTBC0 PGAP re-annotationmetalloregulator ArsR/SmtB family transcription factor
Revised (this work)Metalloregulator ArsR/SmtB family transcription factor. Pfam: HTH_20 (PF12840.14), HTH_5 (PF01022.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71941 TrEMBL · unreviewed · Predicted
UniProt namePossible transcriptional regulatory protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG0640
KEGG orthology K03892

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HTH_20PF12840.14 7.1e-1038–90 Helix-turn-helix domain
HTH_5PF01022.27 1.8e-1740–88 Bacterial regulatory protein, arsR family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: arsC (arsenic-transport integral membrane protein ArsC), high confidence from genomic context alone (score 940 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2643 arsC arsenic-transport integral membrane protein ArsC 954 940 ctx neighborhood:882
Rv1674c transcriptional regulator 816 811 coexpression:777
Rv1931c transcriptional regulator 788 788 coexpression:738
Rv0494 HTH-type transcriptional regulator 788 781 coexpression:780
Rv3167c TetR family transcriptional regulator 764 756 coexpression:756
Rv1460 sufR transcriptional regulator 766 754 coexpression:754
Rv2641 cadI cadmium inducible protein CadI 762 753 ctx neighborhood:703
Rv3183 higA3 transcriptional regulator 746 739 coexpression:739
Rv0767c HTH-type transcriptional regulator 743 735 coexpression:735
Rv1985c lysG HTH-type transcriptional regulator 743 733 coexpression:733
Rv1167c transcriptional regulator 666 654 coexpression:654
Rv0653c transcriptional regulator 666 654 coexpression:654
Rv0792c transcriptional regulator 618 615 coexpression:615
Rv2640c ArsR family transcriptional regulator 602 602 ctx neighborhood:532
Rv2358 smtB HTH-type transcriptional regulator SmtB 565 566 ctx cooccurence:564

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ArsR family transcriptional regulator
  • MTBC0 PGAP product: metalloregulator ArsR/SmtB family transcription factor
  • Pfam (hmmscan --cut_ga): HTH_20 PF12840.14 (E=7e-10), HTH_5 PF01022.27 (E=2e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217158.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HTH_20 (PF12840.14), HTH_5 (PF01022.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0640
  • Curated reference: UniProt P71941 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor arsC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002812|Rv2642|
MSNLHPLPEVASCVVAPLVREPLNPPAAAEMAARFKALADPVRLQLLSSVASRAGGEACVCDISAGVEVSQPTISHHLKVLRDAGLLTSRRRASWVYYAVVPEALTVLSNLLSVHADAAPALGAPA