cadI Resolved · high auto-curated

H37Rv Rv2641 · MTBC0 mtbc0_002811 · 152 aa · 2989500–2989958 (+) · RefSeq NP_217157.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cadmium inducible protein CadI
MTBC0 PGAP re-annotationcadmium-induced metalloenzyme CadI
Revised (this work)Cadmium-induced metalloenzyme CadI. Pfam: Glyoxalase (PF00903.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIR5 SwissProt · reviewed · Evidence at protein level
UniProt nameCadmium-induced protein CadI

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namecadI
eggNOG descriptionGlyoxalase bleomycin resistance protein dioxygenase
Orthologous groupCOG0346
Gene Ontology (6) GO:0008150, GO:0010035, GO:0010038, GO:0042221, GO:0046686, GO:0050896

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.651 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GlyoxalasePF00903.32 6.4e-165–114 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: arsC (arsenic-transport integral membrane protein ArsC), high confidence from genomic context alone (score 817 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2643 arsC arsenic-transport integral membrane protein ArsC 965 817 ctx neighborhood:756 textmining:820
Rv2640c ArsR family transcriptional regulator 872 812 ctx neighborhood:665 cooccurence:453
Rv2642 ArsR family transcriptional regulator 762 753 ctx neighborhood:703
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 676 656 coexpression:645
Rv3148 nuoD NADH-quinone oxidoreductase subunit D 531 512 coexpression:498
Rv3316 sdhC succinate dehydrogenase cytochrome B-556 subunit 526 505 coexpression:502
Rv1171 hyp hypothetical protein 452 453 ctx cooccurence:452
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 440 429 coexpression:427
Rv0306 bluB oxidoreductase 440 428 coexpression:418
Rv3262 fbiB coenzyme F420:L-glutamate ligase 448 427 coexpression:414
Rv3131 NAD(P)H nitroreductase 437 425 coexpression:415
Rv2032 acg NAD(P)H nitroreductase 437 425 coexpression:415
Rv3127 hyp hypothetical protein 436 424 coexpression:414
Rv3368c oxidoreductase 436 424 coexpression:414
Rv0828c deaminase 432 418 coexpression:418

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cadmium inducible protein CadI
  • MTBC0 PGAP product: cadmium-induced metalloenzyme CadI
  • Pfam (hmmscan --cut_ga): Glyoxalase PF00903.32 (E=6e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217157.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Glyoxalase (PF00903.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0346
  • Curated reference: UniProt P9WIR5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 41 functional partner(s); context anchor arsC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002811|Rv2641|cadI
MSRVQLALNVDDLEAAITFYSRLFNAEPAKRKPGYANFAIADPPLKLVLLENPGTGGTLNHLGVEVGSSNTVHAEIARLTEAGLVTEKEIGTTCCFATQDKVWVTGPGGERWEVYTVLADSETFGSGPRHNDTSDGEASMCCDGQVAVGASG