whiB5 Family assigned · medium auto-curated

H37Rv Rv0022c · MTBC0 mtbc0_000027 · 139 aa · 27005–27424 (-) · RefSeq NP_214536.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator WhiB5
MTBC0 PGAP re-annotationtranscriptional regulator WhiB5
Revised (this work)Transcriptional regulator WhiB5. Pfam: Whib (PF02467.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71592 SwissProt · reviewed · Evidence at protein level
UniProt nameTranscriptional regulator WhiB5
Curated functionA transcription factor that is probably redox-responsive. Probably plays a role in immunomodulation and reactivation after chronic infection. Its induction results in transcription of a number of genes including sigM, and the genes for 2 type VII secretion systems ESX-2 and ESX-4. Seems to negatively regulate its own expression. The apo-form has been shown to act as a protein disulfide reductase. The apo- but not holo-form probably binds DNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namewhiB5
eggNOG descriptionActs as a transcriptional regulator. Probably redox- responsive. The apo- but not holo-form probably binds DNA
Orthologous group2AU18
KEGG orthology K18956
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 2.086 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 5 missense, 1 nonsense, 1 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 5.95% of strains (8643) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
WhibPF02467.22 7.6e-117–82 Transcription factor WhiB

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0023 (transcriptional regulator), high confidence from genomic context alone (score 773 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3449 mycP4 membrane-anchored mycosin 801 801 coexpression:801
Rv3448 eccD4 ESX-4 secretion system protein EccD4 799 799 coexpression:799
Rv3446c hyp hypothetical protein 788 788 coexpression:788
Rv0023 transcriptional regulator 773 773 ctx neighborhood:771
Rv0025 hyp hypothetical protein 737 738 ctx neighborhood:737
Rv0027 hyp hypothetical protein 642 642 ctx neighborhood:638
Rv0028 hyp hypothetical protein 641 641 ctx neighborhood:638
Rv0024 NLP/P60 family protein 630 617 ctx neighborhood:615
Rv0021c hyp hypothetical protein 521 521 ctx neighborhood:516
Rv3447c eccC4 ESX-4 secretion system protein EccC4 408 409 coexpression:409
Rv3903c cpnT hyp hypothetical protein 404 404 coexpression:404
Rv0026 hyp hypothetical protein 418 382
Rv1460 sufR transcriptional regulator 401 89
Rv3911 sigM ECF RNA polymerase sigma factor SigM 532 84 textmining:511
Rv3727 oxidoreductase 660 70 textmining:650

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional regulator WhiB5
  • MTBC0 PGAP product: transcriptional regulator WhiB5
  • Pfam (hmmscan --cut_ga): Whib PF02467.22 (E=8e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214536.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Whib (PF02467.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AU18
  • Curated reference: UniProt P71592 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor Rv0023
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000027|Rv0022c|whiB5
MAHPCATDPELWFGYPDDDGSDGAAKARAYERSATQARIQCLRRCPLLQQRRCAQHAVEHRVEYGVWAGIKLPGGQYRKREQLAAAHDVLRRIAGGEINSRQLPDNAALLARNEGLEVTPVPGVVVHLPIAQVGPQPAA