lppO Resolved · high auto-curated

H37Rv Rv2290 · MTBC0 mtbc0_002431 · 171 aa · 2587346–2587861 (+) · RefSeq NP_216806.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LppO
MTBC0 PGAP re-annotationlipoprotein LpqH
Revised (this work)Lipoprotein LpqH. Pfam: Myco_19_kDa (PF05481.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WK71 SwissProt · reviewed · Evidence at protein level
UniProt namePutative lipoprotein LppO

UniProt still lists this protein as Putative lipoprotein LppO; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namelppO
eggNOG descriptionMycobacterium 19 kDa lipoprotein antigen
Orthologous group29KF0
Gene Ontology (2) GO:0005575, GO:0005576

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 0.627 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 9.92% of strains (14405) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Myco_19_kDaPF05481.18 7.3e-1344–170 Mycobacterium 19 kDa lipoprotein antigen

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: sseB (thiosulfate sulfurtransferase SseB), medium confidence from genomic context alone (score 649 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2291 sseB thiosulfate sulfurtransferase SseB 945 649 ctx neighborhood:644 textmining:852
Rv2288 hyp hypothetical protein 512 512 ctx neighborhood:487
Rv2289 cdh CDP-diacylglycerol pyrophosphatase 510 511 ctx neighborhood:487
Rv2287 yjcE Na(+)/H(+) transporter 502 502 ctx neighborhood:499
Rv3669 transmembrane protein 807 65 textmining:803
Rv1352 hyp hypothetical protein 634 55 textmining:629
Rv0418 lpqL lipoprotein aminopeptidase LpqL 522 54 textmining:516
Rv2339 mmpL9 transmembrane transport protein MmpL9 579 53 textmining:574
Rv3469c mhpE 4-hydroxy-2-oxovalerate aldolase MhpE 907 52 textmining:907
Rv1810 hyp hypothetical protein 805 51 textmining:803
Rv1573 phage protein 523 51 textmining:518
Rv3634c galE1 UDP-glucose 4-epimerase 655 50 textmining:652
Rv3467 hyp hypothetical protein 811 47 textmining:810
Rv3470c ilvB2 acetolactate synthase large subunit 653 47 textmining:651
Rv1275 lprC lipoprotein LprC 581 47 textmining:579

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LppO
  • MTBC0 PGAP product: lipoprotein LpqH
  • Pfam (hmmscan --cut_ga): Myco_19_kDa PF05481.18 (E=7e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216806.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Myco_19_kDa (PF05481.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 29KF0
  • Curated reference: UniProt P9WK71 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor sseB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002431|Rv2290|lppO
MTDPRHTVRIAVGATALGVSALGATLPACSAHSGPGSPPSAPSAPAAATVMVEGHTHTISGAVECRTSPAVRTATPSESGTQTTRVNAHDDSASVTLSLSDSTPPDVNGFGISLKIGSVDYQMPYQPVQSPTQVEATRQGKSYTLTGTGHAVIPGQTGMRELPFGVHVTCP