Rv2633c Resolved · high auto-curated

H37Rv Rv2633c · MTBC0 mtbc0_002802 · 161 aa · 2982896–2983381 (-) · RefSeq NP_217149.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationnon-heme di-iron catalase
Revised (this work)Non-heme di-iron catalase. Pfam: Hemerythrin (PF01814.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WL59 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2633c

UniProt still lists this protein as Uncharacterized protein Rv2633c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionHemerythrin HHE cation binding domain
Orthologous groupCOG5592

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.259 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HemerythrinPF01814.29 1.2e-153–116 Hemerythrin HHE cation binding domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0955 (integral membrane protein), high confidence from genomic context alone (score 724 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2632c hyp hypothetical protein 956 786 ctx neighborhood:512 coexpression:580 textmining:803
Rv3896c hyp hypothetical protein 757 757 ctx cooccurence:756
Rv0955 integral membrane protein 723 724 ctx cooccurence:721
Rv1978 hyp hypothetical protein 723 724 ctx cooccurence:722
Rv0688 ferredoxin reductase 730 714 coexpression:500 experimental:434
Rv1869c reductase 730 714 coexpression:500 experimental:434
Rv0252 nirB nitrite reductase large subunit NirB 730 713 coexpression:498 experimental:434
Rv0804 hyp hypothetical protein 698 699 ctx cooccurence:698
Rv2847c cysG multifunctional uroporphyrin-III C-methyltransferase/precorrin-2 oxidase/ferrochelatase 773 690 coexpression:647
Rv3604c transmembrane protein 679 680 ctx cooccurence:679
Rv3074 hyp hypothetical protein 672 673 ctx cooccurence:670
Rv1378c hyp hypothetical protein 665 666 ctx cooccurence:663
Rv0511 hemD uroporphyrin-III C-methyltransferase 706 663 coexpression:617
Rv1057 hyp hypothetical protein 653 653 ctx cooccurence:653
Rv1158c hyp hypothetical protein 639 640 ctx cooccurence:635

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: non-heme di-iron catalase
  • Pfam (hmmscan --cut_ga): Hemerythrin PF01814.29 (E=1e-15)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217149.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Hemerythrin (PF01814.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5592
  • Curated reference: UniProt P9WL59 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 58 functional partner(s); context anchor Rv0955
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002802|Rv2633c|
MNAYDVLKRHHTVLKGLGRKVGEAPVNSEERHVLFDEMLIELDIHFRIEDDLYYPALSAAGKPITGTHAEHRQVVDQLATLLRTPQRAPGYEEEWNVFRTVLEAHADVEERDMIPAPTPVHITDAELEELGDKMAARIEQLRGSPLYTLRTKGKADLLKAI