Rv2636 Family assigned · medium auto-curated
H37Rv Rv2636 · MTBC0 mtbc0_002806 ·
225 aa · 2986274–2986951 (+) ·
RefSeq NP_217152.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | O-phosphotransferase |
|---|---|
| MTBC0 PGAP re-annotation | chloramphenicol phosphotransferase CPT family protein |
| Revised (this work) | Chloramphenicol phosphotransferase CPT family protein. Pfam: CPT (PF07931.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WL55
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative O-phosphotransferase Rv2636 |
| EC (curated) |
EC 2.7.1.-
|
UniProt still lists this protein as Putative O-phosphotransferase Rv2636; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
V Defense mechanisms
|
|---|---|
| eggNOG description | Chloramphenicol phosphotransferase-like protein |
| Orthologous group | COG3896 |
| KEGG orthology |
K18554
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.256 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 4 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.21% of strains (300) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
CPT | PF07931.19 | 9.8e-70 | 23–208 | Chloramphenicol phosphotransferase-like protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0842 (integral membrane protein), medium confidence from genomic context alone (score 602 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2635 hyp |
hypothetical protein | 775 | 774 ctx | neighborhood:773 |
Rv0330c hyp |
hypothetical protein | 637 | 637 ctx | cooccurence:637 |
Rv0842 |
integral membrane protein | 601 | 602 ctx | cooccurence:600 |
Rv2490c PE_PGRS43 |
PE-PGRS family protein PE_PGRS43 | 584 | 584 ctx | cooccurence:584 |
Rv0355c PPE8 |
PPE family protein PPE8 | 578 | 578 ctx | cooccurence:578 |
Rv2337c hyp |
hypothetical protein | 577 | 577 ctx | cooccurence:577 |
Rv3347c PPE55 |
PPE family protein PPE55 | 573 | 573 ctx | cooccurence:573 |
Rv3350c PPE56 |
PPE family protein PPE56 | 573 | 573 ctx | cooccurence:573 |
Rv2634c PE_PGRS46 |
PE-PGRS family protein PE_PGRS46 | 568 | 569 ctx | neighborhood:569 |
Rv2209 |
integral membrane protein | 561 | 561 ctx | cooccurence:561 |
Rv2295 hyp |
hypothetical protein | 560 | 560 ctx | cooccurence:559 |
Rv2637 dedA |
transmembrane protein DedA | 551 | 550 ctx | neighborhood:548 |
Rv1004c |
membrane protein | 543 | 543 ctx | cooccurence:542 |
Rv1917c PPE34 |
PPE family protein PPE34 | 530 | 530 ctx | cooccurence:530 |
Rv0872c PE_PGRS15 |
PE-PGRS family protein PE_PGRS15 | 529 | 529 ctx | cooccurence:529 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: O-phosphotransferase
- MTBC0 PGAP product: chloramphenicol phosphotransferase CPT family protein
- Pfam (hmmscan --cut_ga): CPT PF07931.19 (E=1e-69)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217152.1)
- Domains: Pfam-A via hmmscan --cut_ga — CPT (PF07931.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3896 - Curated reference: UniProt P9WL55 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
39 functional partner(s); context anchor
Rv0842 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002806|Rv2636| MINPTRARRMRYRLAAMAGMPEGKLILLNGGSSAGKTSLALAFQDLAAECWMHIGIDLFWFALPPEQLDLARVRPEYYTWDSAVEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADDVIWTREWLVDALRVFEGCRVWMVGVHVSDEEGARRELERGDRHPGWNRGSARAAHADAEYDFELDTTATPVHELARELHESYQACPYPMAFNRLRKRFLS