Rv2636 Family assigned · medium auto-curated

H37Rv Rv2636 · MTBC0 mtbc0_002806 · 225 aa · 2986274–2986951 (+) · RefSeq NP_217152.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)O-phosphotransferase
MTBC0 PGAP re-annotationchloramphenicol phosphotransferase CPT family protein
Revised (this work)Chloramphenicol phosphotransferase CPT family protein. Pfam: CPT (PF07931.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WL55 SwissProt · reviewed · Evidence at protein level
UniProt namePutative O-phosphotransferase Rv2636
EC (curated) EC 2.7.1.-

UniProt still lists this protein as Putative O-phosphotransferase Rv2636; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
eggNOG descriptionChloramphenicol phosphotransferase-like protein
Orthologous groupCOG3896
KEGG orthology K18554

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.256 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.21% of strains (300) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CPTPF07931.19 9.8e-7023–208 Chloramphenicol phosphotransferase-like protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0842 (integral membrane protein), medium confidence from genomic context alone (score 602 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2635 hyp hypothetical protein 775 774 ctx neighborhood:773
Rv0330c hyp hypothetical protein 637 637 ctx cooccurence:637
Rv0842 integral membrane protein 601 602 ctx cooccurence:600
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 584 584 ctx cooccurence:584
Rv0355c PPE8 PPE family protein PPE8 578 578 ctx cooccurence:578
Rv2337c hyp hypothetical protein 577 577 ctx cooccurence:577
Rv3347c PPE55 PPE family protein PPE55 573 573 ctx cooccurence:573
Rv3350c PPE56 PPE family protein PPE56 573 573 ctx cooccurence:573
Rv2634c PE_PGRS46 PE-PGRS family protein PE_PGRS46 568 569 ctx neighborhood:569
Rv2209 integral membrane protein 561 561 ctx cooccurence:561
Rv2295 hyp hypothetical protein 560 560 ctx cooccurence:559
Rv2637 dedA transmembrane protein DedA 551 550 ctx neighborhood:548
Rv1004c membrane protein 543 543 ctx cooccurence:542
Rv1917c PPE34 PPE family protein PPE34 530 530 ctx cooccurence:530
Rv0872c PE_PGRS15 PE-PGRS family protein PE_PGRS15 529 529 ctx cooccurence:529

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: O-phosphotransferase
  • MTBC0 PGAP product: chloramphenicol phosphotransferase CPT family protein
  • Pfam (hmmscan --cut_ga): CPT PF07931.19 (E=1e-69)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217152.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CPT (PF07931.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3896
  • Curated reference: UniProt P9WL55 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s); context anchor Rv0842
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002806|Rv2636|
MINPTRARRMRYRLAAMAGMPEGKLILLNGGSSAGKTSLALAFQDLAAECWMHIGIDLFWFALPPEQLDLARVRPEYYTWDSAVEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADDVIWTREWLVDALRVFEGCRVWMVGVHVSDEEGARRELERGDRHPGWNRGSARAAHADAEYDFELDTTATPVHELARELHESYQACPYPMAFNRLRKRFLS