Rv2639c Family assigned · low auto-curated

H37Rv Rv2639c · MTBC0 mtbc0_002809 · 110 aa · 2988587–2988919 (-) · RefSeq NP_217155.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotationYnfA family protein
Revised (this work)YnfA family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFN9 SwissProt · reviewed · Inferred from homology
UniProt nameUPF0060 membrane protein Rv2639c

UniProt still lists this protein as UPF0060 membrane protein Rv2639c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionUPF0060 membrane protein
Orthologous groupCOG1742
KEGG orthology K09771
Gene Ontology (2) GO:0005575, GO:0005576

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
UPF0060PF02694.22 1.7e-482–109 Uncharacterised BCR, YnfA/UPF0060 family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2640c (ArsR family transcriptional regulator), medium confidence from genomic context alone (score 549 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2640c ArsR family transcriptional regulator 564 549 ctx neighborhood:542

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: integral membrane protein
  • MTBC0 PGAP product: YnfA family protein
  • Pfam (hmmscan --cut_ga): UPF0060 PF02694.22 (E=2e-48)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217155.1)
  • Domains: Pfam-A via hmmscan --cut_ga — UPF0060 (PF02694.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1742
  • Curated reference: UniProt P9WFN9 (SwissProt, reviewed; Inferred from homology)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 1 functional partner(s); context anchor Rv2640c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002809|Rv2639c|
MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGRVLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH