Rv2632c Family assigned · medium auto-curated

H37Rv Rv2632c · MTBC0 mtbc0_002801 · 93 aa · 2982470–2982751 MTBC0 (-) · RefSeq NP_217148.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv2619c (Rv2619c) — family_assigned: cupin domain-containing protein Rv2620c (Rv2620c) — dark: hypothetical protein Rv2621c (Rv2621c) — family_assigned: helix-turn-helix domain-containing protein Rv2622 (Rv2622) — family_assigned: methyltransferase domain-containing protein TB31.7 (Rv2623) — requalified: universal stress protein TB31.7 TB31.7 Rv2625c (Rv2625c) — family_assigned: site-2 protease family protein Rv2625c hrp1 (Rv2626c) — requalified: hypoxic response protein Hrp1 Rv2627c (Rv2627c) — family_assigned: alpha/beta hydrolase Rv2627c Rv2629 (Rv2629) — family_assigned: hypothetical protein Rv2629 Rv2630 (Rv2630) — requalified: archease Rv2632c (Rv2632c) — family_assigned: DUF1876 domain-containing protein Rv2633c (Rv2633c) — requalified: non-heme di-iron catalase Rv2635 (Rv2635) — requalified: hypothetical protein Rv2636 (Rv2636) — family_assigned: chloramphenicol phosphotransferase CPT family protein dedA (Rv2637) — family_assigned: DedA family protein Rv2638 (Rv2638) — requalified: anti-sigma factor antagonist Rv2639c (Rv2639c) — family_assigned: YnfA family protein Rv2640c (Rv2640c) — family_assigned: Rv2640c family ArsR-like transcriptional regulator cadI (Rv2641) — requalified: cadmium-induced metalloenzyme CadI Rv2642 (Rv2642) — family_assigned: metalloregulator ArsR/SmtB family transcription factor arsC (Rv2643) — family_assigned: ACR3 family arsenite efflux transporter arsC Rv2645 (Rv2645) — family_assigned: hypothetical protein Rv2646 (Rv2646) — requalified: tyrosine-type recombinase/integrase 2 972 kb 2 976 kb 2 980 kb 2 984 kb 2 988 kb 2 992 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF1876 domain-containing protein
Revised (this work)DUF1876 domain-containing protein. Pfam: Rv2632c-like (PF08962.17).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

Found under: H37Rv (1).

1 TB publication mentions this gene. 1 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.

PublicationDate
Three protein cocktails mediate delayed-type hypersensitivity responses indistinguishable from that elicited by purified protein derivative in the guinea pig model of Mycobacterium tuberculosis infection. doi:10.1128/IAI.00486-10 2011

This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

Phenotype-driven functional lead (hypothesis) priority 6.0

required for fitness in vivo (virulence / persistence factor).

Corroborating evidenceconserved / under constraint intra-MTBC; STRING-coupled to Rv3131 (NAD(P)H nitroreductase); structural lead available

This locus is a "hypothetical" with a conditional Tn-seq phenotype. The statement above is a working hypothesis for its functional context, synthesised from the phenotype pattern and the corroborating layers on this page (conservation, STRING coupling, operon, regulon, localisation, structure) — a prioritised requalification candidate to validate, not an established function.

CRISPRi vulnerability

Vulnerability index 0.56 (95% CI -0.36 to 1.69). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2665c · 100.0% identity
M. marinum MMAR_2068 · 76.3% identity
M. orygis RJtmp_002725 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WL61 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2632c

UniProt still lists this protein as Uncharacterized protein Rv2632c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF1876)
Orthologous group2EH65

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

M. canettii dN/dS (deep-divergence selection) inf (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 34/53 (64%) · mean identity 70.0% · 4/4 closest MTBAP relatives
conserved across the genus (present in 34/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 1/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 53.5%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callUncertain · uncertain
What the call meansuncertain (short or TA-poor ORF): no call possible
TA sites (Himar1) 3 in the ORF — 0 in the essential state, 0 growth-defect, 3 non-essential, 0 growth-advantage. Saturation 0.667, mean read count 104.5. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatStatistically thin call: only 3 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) -6.260.038 required
fitness in mouse infection (in vivo) -3.570.047 required

Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 16 of 16 independent MS datasets
Integrated abundance1845.0 ppm · rank 95/3519 (97.3th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length93 aa
Molecular weight10.1 kDa
Theoretical pI4.98
GRAVY-0.269 (hydrophilic)
Aliphatic index94.5
Aromaticity0.022
Instability index29.9 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rv2632c-likePF08962.17 6.5e-309–88 Rv2632c-like

Experimental structures (Protein Data Bank) 1 solved

PDBMethodResolutionCoverage
2fgg X-ray diffraction 2.3 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.4

PDB hitprobTM-scoreE-valueDescription
2fgg-assembly1_A 1.00 0.91 4.2e-12 sig 2fgg-assembly1_A Crystal Structure of Rv2632c
4wpy-assembly1_A-2 1.00 0.93 2.1e-09 sig 4wpy-assembly1_A-2 Racemic crystal structure of Rv1738 from Mycobacterium tuberculosis (Form-II)
4wsp-assembly1_A 1.00 0.92 1.6e-07 sig 4wsp-assembly1_A Racemic crystal structure of Rv1738 from Mycobacterium tuberculosis (Form-I)

Foldseek search of the AlphaFold DB model (mean pLDDT 90.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv2631 (+ strand, 38 bp gap)
Downstream (3' on genome)Rv2633c (- strand, 144 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv3131 (NAD(P)H nitroreductase), medium confidence from genomic context alone (score 439 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2633c hyp hypothetical protein 956 786 ctx neighborhood:512 coexpression:580 textmining:803
Rv2302 hyp hypothetical protein 516 516 ctx cooccurence:494
Rv1366 hyp hypothetical protein 505 505 ctx cooccurence:501
Rv3131 NAD(P)H nitroreductase 440 439 ctx cooccurence:435
Rv3134c universal stress protein 436 436 ctx cooccurence:428
Rv2027c dosT two component sensor histidine kinase DosT 448 427
Rv3127 hyp hypothetical protein 426 425 ctx cooccurence:421
Rv1888c Rv1888c, (MTCY180.30), len: 186 aa. Possible transmembrane protein. 425 425 ctx cooccurence:419
Rv0569 hyp hypothetical protein 415 416 ctx cooccurence:409
Rv3132c devS two component sensor histidine kinase DevS 427 406
Rv1014c pth peptidyl-tRNA hydrolase 401 402
Rv0272c hyp hypothetical protein 451 69 textmining:435
Rv3241c raiA hyp hypothetical protein 872 59 textmining:870
Rv1039c PPE15 PPE family protein PPE15 514 47 textmining:511
Rv1388 mihF integration host factor MihF 438 47 textmining:435

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF1876 domain-containing protein
  • Pfam (hmmscan --cut_ga): Rv2632c-like PF08962.17 (E=7e-30)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217148.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rv2632c-like (PF08962.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EH65
  • Curated reference: UniProt P9WL61 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.4)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor Rv3131
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002801|Rv2632c|
MTDSEHVGKTCQIDVLIEEHDERTRAKARLSWAGRQMVGVGLARLDPADEPVAQIGDELAIARALSDLANQLFALTSSDIEASTHQPVTGLHH