Rv2632c Family assigned · medium auto-curated
H37Rv Rv2632c · MTBC0 mtbc0_002801 ·
93 aa · 2982470–2982751 (-) ·
RefSeq NP_217148.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF1876 domain-containing protein |
| Revised (this work) | DUF1876 domain-containing protein. Pfam: Rv2632c-like (PF08962.17). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WL61
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv2632c |
UniProt still lists this protein as Uncharacterized protein Rv2632c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Domain of unknown function (DUF1876) |
| Orthologous group | 2EH65 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Rv2632c-like | PF08962.17 | 6.5e-30 | 9–88 | Rv2632c-like |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv3131 (NAD(P)H nitroreductase), medium confidence from genomic context alone (score 439 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2633c hyp |
hypothetical protein | 956 | 786 ctx | neighborhood:512 coexpression:580 textmining:803 |
Rv2302 hyp |
hypothetical protein | 516 | 516 ctx | cooccurence:494 |
Rv1366 hyp |
hypothetical protein | 505 | 505 ctx | cooccurence:501 |
Rv3131 |
NAD(P)H nitroreductase | 440 | 439 ctx | cooccurence:435 |
Rv3134c |
universal stress protein | 436 | 436 ctx | cooccurence:428 |
Rv2027c dosT |
two component sensor histidine kinase DosT | 448 | 427 | |
Rv3127 hyp |
hypothetical protein | 426 | 425 ctx | cooccurence:421 |
Rv1888c |
Rv1888c, (MTCY180.30), len: 186 aa. Possible transmembrane protein. | 425 | 425 ctx | cooccurence:419 |
Rv0569 hyp |
hypothetical protein | 415 | 416 ctx | cooccurence:409 |
Rv3132c devS |
two component sensor histidine kinase DevS | 427 | 406 | |
Rv1014c pth |
peptidyl-tRNA hydrolase | 401 | 402 | |
Rv0272c hyp |
hypothetical protein | 451 | 69 | textmining:435 |
Rv3241c raiA hyp |
hypothetical protein | 872 | 59 | textmining:870 |
Rv1039c PPE15 |
PPE family protein PPE15 | 514 | 47 | textmining:511 |
Rv1388 mihF |
integration host factor MihF | 438 | 47 | textmining:435 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: DUF1876 domain-containing protein
- Pfam (hmmscan --cut_ga): Rv2632c-like PF08962.17 (E=7e-30)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217148.1)
- Domains: Pfam-A via hmmscan --cut_ga — Rv2632c-like (PF08962.17)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2EH65 - Curated reference: UniProt P9WL61 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
Rv3131 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002801|Rv2632c| MTDSEHVGKTCQIDVLIEEHDERTRAKARLSWAGRQMVGVGLARLDPADEPVAQIGDELAIARALSDLANQLFALTSSDIEASTHQPVTGLHH