Rv2632c Family assigned · medium auto-curated

H37Rv Rv2632c · MTBC0 mtbc0_002801 · 93 aa · 2982470–2982751 (-) · RefSeq NP_217148.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF1876 domain-containing protein
Revised (this work)DUF1876 domain-containing protein. Pfam: Rv2632c-like (PF08962.17).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WL61 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2632c

UniProt still lists this protein as Uncharacterized protein Rv2632c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF1876)
Orthologous group2EH65

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rv2632c-likePF08962.17 6.5e-309–88 Rv2632c-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3131 (NAD(P)H nitroreductase), medium confidence from genomic context alone (score 439 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2633c hyp hypothetical protein 956 786 ctx neighborhood:512 coexpression:580 textmining:803
Rv2302 hyp hypothetical protein 516 516 ctx cooccurence:494
Rv1366 hyp hypothetical protein 505 505 ctx cooccurence:501
Rv3131 NAD(P)H nitroreductase 440 439 ctx cooccurence:435
Rv3134c universal stress protein 436 436 ctx cooccurence:428
Rv2027c dosT two component sensor histidine kinase DosT 448 427
Rv3127 hyp hypothetical protein 426 425 ctx cooccurence:421
Rv1888c Rv1888c, (MTCY180.30), len: 186 aa. Possible transmembrane protein. 425 425 ctx cooccurence:419
Rv0569 hyp hypothetical protein 415 416 ctx cooccurence:409
Rv3132c devS two component sensor histidine kinase DevS 427 406
Rv1014c pth peptidyl-tRNA hydrolase 401 402
Rv0272c hyp hypothetical protein 451 69 textmining:435
Rv3241c raiA hyp hypothetical protein 872 59 textmining:870
Rv1039c PPE15 PPE family protein PPE15 514 47 textmining:511
Rv1388 mihF integration host factor MihF 438 47 textmining:435

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF1876 domain-containing protein
  • Pfam (hmmscan --cut_ga): Rv2632c-like PF08962.17 (E=7e-30)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217148.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rv2632c-like (PF08962.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EH65
  • Curated reference: UniProt P9WL61 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor Rv3131
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002801|Rv2632c|
MTDSEHVGKTCQIDVLIEEHDERTRAKARLSWAGRQMVGVGLARLDPADEPVAQIGDELAIARALSDLANQLFALTSSDIEASTHQPVTGLHH