Rv0310c Family assigned · medium auto-curated
H37Rv Rv0310c · MTBC0 mtbc0_000330 ·
163 aa · 381980–382471 (-) ·
RefSeq NP_214824.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | nuclear transport factor 2 family protein |
| Revised (this work) | Nuclear transport factor 2 family protein. Pfam: SnoaL_4 (PF13577.13). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O07237
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| Preferred name | baiE |
| eggNOG description | SnoaL-like domain |
| Orthologous group | COG5517 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
SnoaL_4 | PF13577.13 | 2.5e-32 | 13–135 | SnoaL-like domain |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3147 nuoC |
NADH-quinone oxidoreductase subunit C | 997 | 997 | coexpression:724 experimental:928 database:844 |
Rv3153 nuoI |
NADH-quinone oxidoreductase subunit I | 996 | 996 | coexpression:685 experimental:928 database:844 |
Rv3148 nuoD |
NADH-quinone oxidoreductase subunit D | 996 | 996 | coexpression:654 experimental:928 database:844 |
Rv3146 nuoB |
NADH-quinone oxidoreductase subunit B | 994 | 994 | coexpression:507 experimental:928 database:844 |
Rv3151 nuoG |
NADH-quinone oxidoreductase subunit G | 993 | 992 | coexpression:634 experimental:928 database:738 |
Rv3150 nuoF |
NADH-quinone oxidoreductase subunit F | 991 | 990 | coexpression:722 experimental:928 database:561 |
Rv3149 nuoE |
NADH-quinone oxidoreductase subunit E | 989 | 988 | coexpression:648 experimental:928 database:561 |
Rv3157 nuoM |
NADH-quinone oxidoreductase subunit M | 979 | 979 | experimental:928 database:667 |
Rv3145 nuoA |
NADH-quinone oxidoreductase subunit A | 979 | 978 | experimental:928 database:667 |
Rv3158 nuoN |
NADH-quinone oxidoreductase subunit N | 978 | 976 | experimental:928 database:658 |
Rv3152 nuoH |
NADH-quinone oxidoreductase subunit H | 978 | 975 | experimental:928 database:667 |
Rv2195 qcrA |
ubiquinol-cytochrome C reductase rieske iron-sulfur subunit | 976 | 973 | coexpression:647 experimental:924 |
Rv2782c pepR |
zinc protease | 956 | 950 | coexpression:409 experimental:919 |
Rv2196 qcrB |
ubiquinol-cytochrome C reductase cytochrome subunit B | 917 | 912 | experimental:902 |
Rv2946c pks1 |
polyketide synthase | 931 | 903 | coexpression:450 experimental:594 database:561 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: nuclear transport factor 2 family protein
- Pfam (hmmscan --cut_ga): SnoaL_4 PF13577.13 (E=3e-32)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214824.1)
- Domains: Pfam-A via hmmscan --cut_ga — SnoaL_4 (PF13577.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG5517 - Curated reference: UniProt O07237 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 192 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000330|Rv0310c| MCCNGVVTPGDPADIAAIKQLKYRYLRALDTKHWDDFTDTLAEDVTGDYGSSVGTELHFTNRADLVDYLRQALGPGVITEHRVTHPEITVTGDTATGIWYLQDRVIVAEFNFMLIGAAFYHDQYRRTTDGWRISATGYDRTYEATMSLAGLNFNIRPGRALAD