Rv0310c Family assigned · medium auto-curated

H37Rv Rv0310c · MTBC0 mtbc0_000330 · 163 aa · 381980–382471 (-) · RefSeq NP_214824.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationnuclear transport factor 2 family protein
Revised (this work)Nuclear transport factor 2 family protein. Pfam: SnoaL_4 (PF13577.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07237 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
Preferred namebaiE
eggNOG descriptionSnoaL-like domain
Orthologous groupCOG5517

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SnoaL_4PF13577.13 2.5e-3213–135 SnoaL-like domain

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv3147 nuoC NADH-quinone oxidoreductase subunit C 997 997 coexpression:724 experimental:928 database:844
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 996 996 coexpression:685 experimental:928 database:844
Rv3148 nuoD NADH-quinone oxidoreductase subunit D 996 996 coexpression:654 experimental:928 database:844
Rv3146 nuoB NADH-quinone oxidoreductase subunit B 994 994 coexpression:507 experimental:928 database:844
Rv3151 nuoG NADH-quinone oxidoreductase subunit G 993 992 coexpression:634 experimental:928 database:738
Rv3150 nuoF NADH-quinone oxidoreductase subunit F 991 990 coexpression:722 experimental:928 database:561
Rv3149 nuoE NADH-quinone oxidoreductase subunit E 989 988 coexpression:648 experimental:928 database:561
Rv3157 nuoM NADH-quinone oxidoreductase subunit M 979 979 experimental:928 database:667
Rv3145 nuoA NADH-quinone oxidoreductase subunit A 979 978 experimental:928 database:667
Rv3158 nuoN NADH-quinone oxidoreductase subunit N 978 976 experimental:928 database:658
Rv3152 nuoH NADH-quinone oxidoreductase subunit H 978 975 experimental:928 database:667
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 976 973 coexpression:647 experimental:924
Rv2782c pepR zinc protease 956 950 coexpression:409 experimental:919
Rv2196 qcrB ubiquinol-cytochrome C reductase cytochrome subunit B 917 912 experimental:902
Rv2946c pks1 polyketide synthase 931 903 coexpression:450 experimental:594 database:561

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: nuclear transport factor 2 family protein
  • Pfam (hmmscan --cut_ga): SnoaL_4 PF13577.13 (E=3e-32)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214824.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SnoaL_4 (PF13577.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5517
  • Curated reference: UniProt O07237 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 192 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000330|Rv0310c|
MCCNGVVTPGDPADIAAIKQLKYRYLRALDTKHWDDFTDTLAEDVTGDYGSSVGTELHFTNRADLVDYLRQALGPGVITEHRVTHPEITVTGDTATGIWYLQDRVIVAEFNFMLIGAAFYHDQYRRTTDGWRISATGYDRTYEATMSLAGLNFNIRPGRALAD