cysQ Resolved · high auto-curated
H37Rv Rv2131c · MTBC0 mtbc0_002264 ·
267 aa ·
2419780–2420583 MTBC0
(-) ·
RefSeq NP_216647.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 3'(2'),5'-bisphosphate nucleotidase CysQ |
|---|---|
| MTBC0 PGAP re-annotation | 3'(2')%2C5'-bisphosphate nucleotidase CysQ |
| Revised (this work) | 3'(2')%2C5'-bisphosphate nucleotidase CysQ. Pfam: Inositol_P (PF00459.31). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 8 publications
8 TB publications mention this gene. 8 publication(s) discuss this gene (7 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (2)).
| Publication | Date |
|---|---|
| Crystal Structures of Mycobacterium tuberculosis CysQ, with Substrate and Products Bound. doi:10.1021/acs.biochem.5b01000 | 2015 |
| Expression, purification and preliminary crystallographic analysis of Mycobacterium tuberculosis CysQ, a phosphatase involved in sulfur metabolism. doi:10.1107/S2053230X14008619 | 2014 |
| Unique subunit packing in mycobacterial nanoRNase leads to alternate substrate recognitions in DHH phosphodiesterases. doi:10.1093/nar/gku425 | 2014 |
| Characterization of NrnA homologs from Mycobacterium tuberculosis and Mycoplasma pneumoniae. doi:10.1261/rna.029132.111 | 2012 |
| The Mycobacterium tuberculosis CysQ phosphatase modulates the biosynthesis of sulfated glycolipids and bacterial growth. doi:10.1016/j.bmcl.2011.06.057 | 2011 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.78 (95% CI -2.36 to 4.92). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Can dephosphorylate a broad range of substrates. Likely involved in sulfur metabolism, controlling the pool of 3'-phosphoadenosine 5'-phosphate (pap) and 3'-phosphoadenoside 5'-phosphosulfate (PAPS) [catalytic activity: adenosine 3',5'-bisphosphate + H2O = adenosine 5'-phosphate + phosphate]. Has also been shown to have myo-inositol 1-phosphatase [catalytic activity: myo-inositol 1-phosphate + H(2 |
|---|---|
| Mycobrowser EC |
3.1.3.-
· superseded EC numbering; the atlas uses the current class (3.1.3.11, 3.1.3.25, 3.1.3.7)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2155c
· 99.6% identity |
|---|---|
| M. leprae |
ML1301
· 78.5% identity |
| M. marinum |
MMAR_3112
· 79.8% identity |
| M. smegmatis |
MSMEG_4190
· 65.1% identity |
| M. orygis |
RJtmp_002199
· 99.6% identity |
| M. abscessus |
MAB_2115
· 63.6% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WKJ1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | 3'-phosphoadenosine 5'-phosphate phosphatase |
| EC (curated) |
EC 3.1.3.11, EC 3.1.3.25, EC 3.1.3.7
|
| Curated function | Phosphatase with a broad specificity. Its primary physiological function is to dephosphorylate 3'-phosphoadenosine 5'-phosphate (PAP) and 3'-phosphoadenosine 5'-phosphosulfate (PAPS). Thus, plays a role in mycobacterial sulfur metabolism, since it can serve as a key regulator of the sulfate assimilation pathway by controlling the pools of PAP and PAPS in the cell. To a lesser extent, is also able to hydrolyze inositol 1-phosphate (I-1-P), fructose 1,6-bisphosphate (FBP) (to fructose 6-phosphate (F-6-P)) and AMP in vitro, but this might not be significant in vivo. Glucose-1-phosphate (G-1-P), p. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | cysQ |
| eggNOG description | Inositol monophosphatase |
| Orthologous group | COG1218 |
| EC number |
EC 3.1.3.7
|
| KEGG orthology |
K01082
|
| KEGG pathways |
map00920, map01100, map01120, map01130
|
| Gene Ontology (64) |
GO:0000103, GO:0000287, GO:0003674, GO:0003824, GO:0005488, GO:0005575, GO:0005623, GO:0005886, GO:0006082, GO:0006139, GO:0006163, GO:0006725 +52 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.122 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 78.9%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 49.8% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 9 in the ORF — 0 in the essential state, 0 growth-defect, 9 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 85.7777777778. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 9 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 9 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| altered fitness under Isoniazid (drug exposure) | +9.05 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +6.60 | 0.0 | disruption advantageous |
| altered fitness under Isoniazid (drug exposure) | +5.89 | 0.0 | disruption advantageous |
| fitness after prolonged in vitro passage (in vitro passage) | -5.31 | 0.0 | required |
| fitness in mouse infection, day 10 (in vivo) | -4.63 | 0.032 | required |
| fitness in mouse infection, day 45 (in vivo) | -4.63 | 0.0039 | required |
| fitness in mouse infection (in vivo) | +1.89 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.86 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.57 | 0.0092 | disruption advantageous |
| fitness in mouse infection (in vivo) | +1.52 | 0.029 | disruption advantageous |
| altered fitness under 6 weeks hypoxia (stress) | +1.21 | 0.018 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 11 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 245.0 ppm · rank 747/3519 (78.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 267 aa |
|---|---|
| Molecular weight | 28.4 kDa |
| Theoretical pI | 4.85 |
| GRAVY | -0.067 (hydrophilic) |
| Aliphatic index | 98.1 |
| Aromaticity | 0.052 |
| Instability index | 40.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Inositol_P | PF00459.31 | 1.1e-25 | 45–240 | Inositol monophosphatase family |
Experimental structures (Protein Data Bank) 6 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
5djh |
X-ray diffraction | 1.451 Å | 100% |
5djj |
X-ray diffraction | 1.501 Å | 100% |
5dji |
X-ray diffraction | 1.659 Å | 100% |
5djf |
X-ray diffraction | 1.7 Å | 100% |
5djk |
X-ray diffraction | 1.799 Å | 100% |
5djg |
X-ray diffraction | 1.951 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (6 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.7
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5djf-assembly1_A |
1.00 | 0.98 | 3.8e-49 sig | 5djf-assembly1_A Structure of M. tuberculosis CysQ, a PAP phosphatase - ligand-free structure |
5djk-assembly1_A |
1.00 | 0.98 | 2.2e-48 sig | 5djk-assembly1_A Structure of M. tuberculosis CysQ, a PAP phosphatase with PO4 and 2Ca bound |
5djg-assembly1_A |
1.00 | 0.97 | 2.4e-47 sig | 5djg-assembly1_A Structure of M. tuberculosis CysQ, a PAP phosphatase with PAP, Mg, and Li bound |
5dji-assembly1_A |
1.00 | 0.97 | 5.8e-47 sig | 5dji-assembly1_A Structure of M. tuberculosis CysQ, a PAP phosphatase with AMP, PO4, and 2Mg bound |
5djh-assembly1_A |
1.00 | 0.96 | 1.1e-45 sig | 5djh-assembly1_A Structure of M. tuberculosis CysQ, a PAP phosphatase with AMP, PO4, and 3Mg bound |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | mshC (- strand, 57 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2132 (+ strand, 90 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv0324 (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: mshC (cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase), high confidence from genomic context alone (score 814 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1286 cysC exp |
adenylyl-sulfate kinase | 982 | 963 | database:900 textmining:554 |
Rv1285 cysD exp |
sulfate adenylyltransferase subunit 2 | 940 | 930 | database:900 |
Rv2392 cysH exp |
phosphoadenosine phosphosulfate reductase | 968 | 911 | database:900 textmining:659 |
Rv2837c nrnA exp |
bifunctional oligoribonuclease/PAP phosphatase NrnA | 963 | 901 | database:900 textmining:644 |
Rv2130c mshC |
cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase | 823 | 814 ctx | neighborhood:805 |
Rv2129c |
oxidoreductase | 609 | 609 ctx | neighborhood:555 |
Rv2132 hyp |
hypothetical protein | 572 | 572 ctx | neighborhood:572 |
Rv2764c thyA |
thymidylate synthase ThyA | 566 | 567 | coexpression:461 |
Rv2134c hyp |
hypothetical protein | 563 | 563 ctx | neighborhood:544 |
Rv0363c fba exp |
fructose-bisphosphate aldolase | 561 | 562 | database:500 |
Rv2136c uppP |
undecaprenyl-diphosphatase | 560 | 561 ctx | neighborhood:544 |
Rv2133c hyp |
hypothetical protein | 550 | 550 ctx | neighborhood:544 |
Rv2135c hyp |
hypothetical protein | 573 | 549 ctx | neighborhood:544 |
Rv2137c hyp |
hypothetical protein | 545 | 546 ctx | neighborhood:544 |
Rv0946c pgi exp |
glucose-6-phosphate isomerase | 550 | 533 | database:500 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 3'(2'),5'-bisphosphate nucleotidase CysQ
- MTBC0 PGAP product: 3'(2')%2C5'-bisphosphate nucleotidase CysQ
- Pfam (hmmscan --cut_ga): Inositol_P PF00459.31 (E=1e-25)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216647.1)
- Domains: Pfam-A via hmmscan --cut_ga — Inositol_P (PF00459.31)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1218 - Curated reference: UniProt P9WKJ1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.7)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
34 functional partner(s); context anchor
mshC - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002264|Rv2131c|cysQ MVSPAAPDLTDDLTDAELAADLAADAGKLLLQVRAEIGFDQPWTLGEAGDRQANSLLLRRLQAERPGDAVLSEEAHDDLARLKSDRVWIIDPLDGTREFSTPGRDDWAVHIALWRRSSNGQPEITDAAVALPARGNVVYRTDTVTSGAAPAGVPGTLRIAVSATRPPAVLHRIRQTLAIQPVSIGSAGAKAMAVIDGYVDAYLHAGGQWEWDSAAPAGVMLAAGMHASRLDGSPLRYNQLDPYLPDLLMCRAEVAPILLGAIADAWR
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for cysQ? Email the maintainer — the message is pre-filled with this gene's details.