Rv2136c Resolved · high auto-curated

H37Rv Rv2136c · MTBC0 mtbc0_002269 · 276 aa · 2423271–2424101 (-) · RefSeq NP_216652.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)undecaprenyl-diphosphatase
MTBC0 PGAP re-annotationundecaprenyl-diphosphate phosphatase
Revised (this work)Undecaprenyl-diphosphate phosphatase. Pfam: BacA (PF02673.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFF9 SwissProt · reviewed · Evidence at protein level
UniProt nameUndecaprenyl-diphosphatase
EC (curated) EC 3.6.1.27
Curated functionCatalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
Preferred nameuppP
eggNOG descriptionCatalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin
Orthologous groupCOG1968
EC number EC 3.6.1.27
KEGG orthology K06153
KEGG pathways map00550
Gene Ontology (4) GO:0006950, GO:0008150, GO:0050896, GO:0051409

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.621 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
BacAPF02673.25 1.4e-797–262 Bacitracin resistance protein BacA

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cysQ (3'(2'),5'-bisphosphate nucleotidase CysQ), medium confidence from genomic context alone (score 561 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2156c murX phospho-N-acetylmuramoyl-pentappeptidetransferase 926 919 database:900
Rv2135c hyp hypothetical protein 958 912 ctx neighborhood:882 textmining:549
Rv2134c hyp hypothetical protein 806 807 ctx neighborhood:800
Rv2137c hyp hypothetical protein 841 801 ctx neighborhood:800
Rv2133c hyp hypothetical protein 801 801 ctx neighborhood:798
Rv2131c cysQ 3'(2'),5'-bisphosphate nucleotidase CysQ 560 561 ctx neighborhood:544
Rv1302 rfe decaprenyl-phosphate N-acetylglucosaminephosphotransferase 598 556 database:500
Rv3859c gltB glutamate synthase large subunit 546 547 ctx neighborhood:544
Rv2130c mshC cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase 525 526 ctx neighborhood:519
Rv2138 lppL lipoprotein LppL 509 510 ctx neighborhood:505
Rv2361c uppS decaprenyl diphosphate synthase 565 506 database:500
Rv2139 pyrD dihydroorotate dehydrogenase 424 423 ctx neighborhood:407
Rv2124c metH methionine synthase 430 402
Rv3682 ponA2 bifunctional penicillin-insensitive transglycosylase/penicillin-sensitive transpeptidase 578 311 textmining:413
Rv2157c murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase 445 216

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: undecaprenyl-diphosphatase
  • MTBC0 PGAP product: undecaprenyl-diphosphate phosphatase
  • Pfam (hmmscan --cut_ga): BacA PF02673.25 (E=1e-79)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216652.1)
  • Domains: Pfam-A via hmmscan --cut_ga — BacA (PF02673.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1968
  • Curated reference: UniProt P9WFF9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor cysQ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002269|Rv2136c|
MSWWQVIVLAAAQGLTEFLPVSSSGHLAIVSRIFFSGDAGASFTAVSQLGTEAAVVIYFARDIVRILSAWLHGLVVKAHRNTDYRLGWYVIIGTIPICILGLFFKDDIRSGVRNLWVVVTALVVFSGVIALAEYVGRQSRHIERLTWRDAVVVGIAQTLALVPGVSRSGSTISAGLFLGLDRELAARFGFLLAIPAVFASGLFSLPDAFHPVTEGMSATGPQLLVATLIAFVLGLTAVAWLLRFLVRHNMYWFVGYRVLVGTGMLVLLATGTVAAT