Rv0513 Family assigned · medium auto-curated
H37Rv Rv0513 · MTBC0 mtbc0_000541 ·
182 aa · 609061–609609 (+) ·
RefSeq NP_215027.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transmembrane protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF3093 domain-containing protein |
| Revised (this work) | DUF3093 domain-containing protein. Pfam: UCP026610 (PF27726.1). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O33358
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible conserved transmembrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2F3K6 |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
UCP026610 | PF27726.1 | 3.9e-102 | 2–181 | Uncharacterised conserved protein UCP026610 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0514 (transmembrane protein), high confidence from genomic context alone (score 967 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0514 |
transmembrane protein | 966 | 967 ctx | neighborhood:881 coexpression:732 |
Rv0511 hemD |
uroporphyrin-III C-methyltransferase | 952 | 953 ctx | neighborhood:773 coexpression:801 |
Rv0510 hemC |
porphobilinogen deaminase | 928 | 928 ctx | neighborhood:744 coexpression:732 |
Rv0512 hemB |
delta-aminolevulinic acid dehydratase | 903 | 903 ctx | neighborhood:869 |
Rv0509 hemA |
glutamyl-tRNA reductase | 788 | 788 ctx | neighborhood:741 |
Rv3806c ubiA |
decaprenyl-phosphate phosphoribosyltransferase | 783 | 783 | coexpression:783 |
Rv2138 lppL |
lipoprotein LppL | 749 | 749 ctx | cooccurence:743 |
Rv1797 eccE5 |
ESX-5 type VII secretion system protein EccE | 735 | 735 | coexpression:735 |
Rv1297 rho |
transcription termination factor Rho | 734 | 734 | coexpression:734 |
Rv0015c pknA |
serine/threonine-protein kinase PknA | 733 | 733 | coexpression:733 |
Rv3920c hyp |
hypothetical protein | 732 | 732 | coexpression:732 |
Rv3220c pdtaS |
two component sensor kinase | 730 | 730 | coexpression:730 |
Rv3156 nuoL |
NADH-quinone oxidoreductase subunit L | 730 | 730 | coexpression:730 |
Rv3212 hyp |
hypothetical protein | 726 | 726 | coexpression:580 |
Rv3906c hyp |
hypothetical protein | 721 | 721 ctx | cooccurence:717 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transmembrane protein
- MTBC0 PGAP product: DUF3093 domain-containing protein
- Pfam (hmmscan --cut_ga): UCP026610 PF27726.1 (E=4e-102)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215027.1)
- Domains: Pfam-A via hmmscan --cut_ga — UCP026610 (PF27726.1)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2F3K6 - Curated reference: UniProt O33358 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
89 functional partner(s); context anchor
Rv0514 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000541|Rv0513| MTPTGDTKPKLLFYEPGASWYWVLTGPLAAVSVLLLEISSGAGVGLITPAIFLVMVSAFVALQVKAARIHTSVELTHDALRQGTETIRLAEIVKIYPEADGRETSGEEPAKWQSARTLGELVGVPRGRVGIGLKLTGGRTAQAWARRHQQLRAALTPLVQERLGPVDSDVADVNGDDAGPAR