Rv0513 Family assigned · medium auto-curated

H37Rv Rv0513 · MTBC0 mtbc0_000541 · 182 aa · 609061–609609 (+) · RefSeq NP_215027.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationDUF3093 domain-containing protein
Revised (this work)DUF3093 domain-containing protein. Pfam: UCP026610 (PF27726.1).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O33358 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible conserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2F3K6

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
UCP026610PF27726.1 3.9e-1022–181 Uncharacterised conserved protein UCP026610

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0514 (transmembrane protein), high confidence from genomic context alone (score 967 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0514 transmembrane protein 966 967 ctx neighborhood:881 coexpression:732
Rv0511 hemD uroporphyrin-III C-methyltransferase 952 953 ctx neighborhood:773 coexpression:801
Rv0510 hemC porphobilinogen deaminase 928 928 ctx neighborhood:744 coexpression:732
Rv0512 hemB delta-aminolevulinic acid dehydratase 903 903 ctx neighborhood:869
Rv0509 hemA glutamyl-tRNA reductase 788 788 ctx neighborhood:741
Rv3806c ubiA decaprenyl-phosphate phosphoribosyltransferase 783 783 coexpression:783
Rv2138 lppL lipoprotein LppL 749 749 ctx cooccurence:743
Rv1797 eccE5 ESX-5 type VII secretion system protein EccE 735 735 coexpression:735
Rv1297 rho transcription termination factor Rho 734 734 coexpression:734
Rv0015c pknA serine/threonine-protein kinase PknA 733 733 coexpression:733
Rv3920c hyp hypothetical protein 732 732 coexpression:732
Rv3220c pdtaS two component sensor kinase 730 730 coexpression:730
Rv3156 nuoL NADH-quinone oxidoreductase subunit L 730 730 coexpression:730
Rv3212 hyp hypothetical protein 726 726 coexpression:580
Rv3906c hyp hypothetical protein 721 721 ctx cooccurence:717

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: DUF3093 domain-containing protein
  • Pfam (hmmscan --cut_ga): UCP026610 PF27726.1 (E=4e-102)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215027.1)
  • Domains: Pfam-A via hmmscan --cut_ga — UCP026610 (PF27726.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2F3K6
  • Curated reference: UniProt O33358 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 89 functional partner(s); context anchor Rv0514
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000541|Rv0513|
MTPTGDTKPKLLFYEPGASWYWVLTGPLAAVSVLLLEISSGAGVGLITPAIFLVMVSAFVALQVKAARIHTSVELTHDALRQGTETIRLAEIVKIYPEADGRETSGEEPAKWQSARTLGELVGVPRGRVGIGLKLTGGRTAQAWARRHQQLRAALTPLVQERLGPVDSDVADVNGDDAGPAR