Rv2133c Family assigned · low auto-curated

H37Rv Rv2133c · MTBC0 mtbc0_002266 · 262 aa · 2421114–2421902 (-) · RefSeq NP_216649.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationSCO1664 family protein
Revised (this work)SCO1664 family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06242 SwissProt · reviewed · Evidence at protein level
UniProt nameProtein Rv2133c

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category B Chromatin structure and dynamics
D Cell cycle control, cell division, chromosome partitioning
L Replication, recombination and repair
T Signal transduction mechanisms
U Intracellular trafficking, secretion and vesicular transport
eggNOG descriptionPhosphatidylinositol
Orthologous groupCOG5032

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.062 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.32% of strains (465) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: uppP (undecaprenyl-diphosphatase), high confidence from genomic context alone (score 801 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2134c hyp hypothetical protein 975 975 ctx neighborhood:879 cooccurence:773
Rv2135c hyp hypothetical protein 950 951 ctx neighborhood:798 cooccurence:760
Rv2101 helZ helicase HelZ 922 915 experimental:832 database:485
Rv3036c TB22.2 hyp hypothetical protein 871 863 experimental:772 database:425
Rv2328 PE23 PE family protein PE23 871 863 experimental:772 database:425
Rv3812 PE_PGRS62 PE-PGRS family protein PE_PGRS62 871 863 experimental:772 database:425
Rv0832 PE_PGRS12 PE-PGRS family protein PE_PGRS12 871 863 experimental:772 database:425
Rv2136c uppP undecaprenyl-diphosphatase 801 801 ctx neighborhood:798
Rv3834c serS serine--tRNA ligase 771 771 experimental:771
Rv2137c hyp hypothetical protein 741 742 ctx neighborhood:740
Rv2130c mshC cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase 748 738 ctx neighborhood:544 cooccurence:416
Rv1170 mshB 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase 641 642 ctx cooccurence:640
Rv0959 hyp hypothetical protein 579 579 ctx cooccurence:451
Rv1082 mca mycothiol S-conjugate amidase 571 571 ctx cooccurence:569
Rv2131c cysQ 3'(2'),5'-bisphosphate nucleotidase CysQ 550 550 ctx neighborhood:544

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: SCO1664 family protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216649.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5032
  • Curated reference: UniProt O06242 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor uppP
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002266|Rv2133c|
MLADGELTVLGRIRSASNATFLCESTLGLRSLHCVYKPVSGERPLWDFPDGTLAGRELSAYLVSTQLGWNLVPHTIIRDGPAGIGMLQLWVQQPGDAVDSDPLPGPDLVDLFPAHRPRPGYLPVLRAYDYAGDEVVLMHADDIRLRRMAVFDVLINNADRKGGHILCGIDGQVYGVDHGLCLHVENKLRTVLWGWAGKPIDDQILQAVAGLADALGGPLAEALAGRIAAAEIGALRRRAQSLLDQPVMPGPNGHRPIPWPAF