TB18.6 Family assigned · medium auto-curated

H37Rv Rv2140c · MTBC0 mtbc0_002274 · 176 aa · 2427061–2427591 MTBC0 (-) · RefSeq NP_216656.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv2128 (Rv2128) — dark: hypothetical protein Rv2129c (Rv2129c) — family_assigned: SDR family oxidoreductase Rv2129c mshC (Rv2130c) — requalified: cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyra mshC cysQ (Rv2131c) — requalified: 3'(2')%2C5'-bisphosphate nucleotidase CysQ Rv2132 (Rv2132) — family_assigned: ribbon-helix-helix protein%2C CopG family Rv2133c (Rv2133c) — family_assigned: SCO1664 family protein Rv2135c (Rv2135c) — family_assigned: histidine phosphatase family protein Rv2136c (Rv2136c) — requalified: undecaprenyl-diphosphate phosphatase Rv2136c lppL (Rv2138) — family_assigned: hypothetical protein lppL pyrD (Rv2139) — requalified: quinone-dependent dihydroorotate dehydrogenase pyrD TB18.6 (Rv2140c) — family_assigned: YbhB/YbcL family Raf kinase inhibitor-like protein parE2 (Rv2142c) — family_assigned: type II toxin-antitoxin system RelE/ParE family toxin Rv2143 (Rv2143) — family_assigned: phosphoribosyltransferase family protein Rv2143 Rv2144c (Rv2144c) — dark: hypothetical protein wag31 (Rv2145c) — requalified: cell wall synthesis protein Wag31 Rv2146c (Rv2146c) — family_assigned: YggT family protein Rv2148c (Rv2148c) — family_assigned: YggS family pyridoxal phosphate-dependent enzyme ftsZ (Rv2150c) — requalified: cell division protein FtsZ ftsZ ftsQ (Rv2151c) — requalified: cell division protein FtsQ ftsQ murC (Rv2152c) — requalified: UDP-N-acetylmuramate--L-alanine ligase murC 2 416 kb 2 420 kb 2 424 kb 2 428 kb 2 432 kb 2 436 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationYbhB/YbcL family Raf kinase inhibitor-like protein
Revised (this work)YbhB/YbcL family Raf kinase inhibitor-like protein. Pfam: PBP (PF01161.26).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 8 publications

Found under: H37Rv (8).

8 TB publications mention this gene. 8 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.

Most recent 5 of 8.
PublicationDate
Mycobacterium tuberculosis RKIP (Rv2140c) dephosphorylates ERK/NF-κB upstream signaling molecules to subvert macrophage innate immune response. doi:10.1016/j.meegid.2021.105019 2021
Mycobacterium tuberculosis Binds Human Serum Amyloid A, and the Interaction Modulates the Colonization of Human Macrophages and the Transcriptional Response of the Pathogen. doi:10.3390/cells10051264 2021
Mycobacterium tuberculosis Raf kinase inhibitor protein (RKIP) Rv2140c is involved in cell wall arabinogalactan biosynthesis via phosphorylation. doi:10.1016/j.micres.2020.126615 2021
Secretory Proteome Analysis of Streptomycin-Resistant Mycobacterium tuberculosis Clinical Isolates. doi:10.1177/2472555217698428 2017
Cytosolic Proteome Profiling of Aminoglycosides Resistant Mycobacterium tuberculosis Clinical Isolates Using MALDI-TOF/MS. doi:10.3389/fmicb.2016.01816 2016

This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

Intrinsic disorder (sequence + structure) partially disordered

Predicted disorder30% of residues (metapredict) · mean AlphaFold pLDDT 96.8
Disordered regions1 IDR(s), longest 52 aa [0-52]

carries a substantial disordered region (52/176 residues); disorder is a property, not a function

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

Phenotype-driven functional lead (hypothesis) priority 6.0

required for fitness in vivo (virulence / persistence factor).

Corroborating evidenceconserved / under constraint intra-MTBC; co-transcribed with TB18.6; structural lead available

This locus is a "hypothetical" with a conditional Tn-seq phenotype. The statement above is a working hypothesis for its functional context, synthesised from the phenotype pattern and the corroborating layers on this page (conservation, STRING coupling, operon, regulon, localisation, structure) — a prioritised requalification candidate to validate, not an established function.

Post-translational modifications

1 reported modified residue(s): N-acetylthreonine @2.

Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).

CRISPRi vulnerability

Vulnerability index -0.01 (95% CI -1.92 to 2.44). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2164c · 100.0% identity
M. leprae ML1289 · 86.3% identity
M. marinum MMAR_3122 · 89.0% identity
M. smegmatis MSMEG_4199 · 77.6% identity
M. orygis RJtmp_002209 · 100.0% identity
M. abscessus MAB_2103 · 77.5% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WFN1 SwissProt · reviewed · Evidence at protein level
UniProt nameUPF0098 protein Rv2140c

UniProt still lists this protein as UPF0098 protein Rv2140c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameybhB
eggNOG descriptionPhospholipid-binding protein
Orthologous groupCOG1881
KEGG orthology K06910
Gene Ontology (11) GO:0003674, GO:0005488, GO:0005515, GO:0005575, GO:0005576, GO:0005623, GO:0005886, GO:0016020, GO:0042802, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.58 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 3 consensus substitution(s)
low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 85.0% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 57.7%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 12 in the ORF — 0 in the essential state, 0 growth-defect, 12 non-essential, 0 growth-advantage. Saturation 0.917, mean read count 56.3636363636. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness after prolonged in vitro passage (in vitro passage) -5.770.0 required
fitness in mouse infection (in vivo) -5.720.031 required
fitness in mouse infection (in vivo) -5.130.021 required
fitness in mouse infection (in vivo) -5.060.0075 required
fitness in mouse infection (in vivo) -4.880.015 required
fitness in mouse infection, day 45 (in vivo) -4.700.0039 required
fitness in mouse infection (in vivo) -4.350.0 required
fitness in mouse infection (in vivo) -4.280.007 required
fitness in mouse infection (in vivo) -3.950.0074 required
fitness in mouse infection (in vivo) -3.930.0 required
fitness in mouse infection (in vivo) -3.800.014 required
fitness in mouse infection (in vivo) -3.790.0048 required

Conditional fitness of transposon-disruption mutants across 42 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 16 of 16 independent MS datasets
Integrated abundance2580.0 ppm · rank 48/3519 (98.7th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length176 aa
Molecular weight18.6 kDa
Theoretical pI5.41
GRAVY-0.104 (hydrophilic)
Aliphatic index77.7
Aromaticity0.097
Instability index47.6 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PBPPF01161.26 3.7e-3839–173 Phosphatidylethanolamine-binding protein

Experimental structures (Protein Data Bank) 1 solved

PDBMethodResolutionCoverage
4beg X-ray diffraction 1.42 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.8

PDB hitprobTM-scoreE-valueDescription
4beg-assembly1_A 1.00 0.98 4.5e-34 sig 4beg-assembly1_A Structure of Rv2140c, a phosphatidyl-ethanolamine binding protein from Mycobacterium tuberculosis in complex with sulphate
1fjj-assembly1_A-2 1.00 0.96 4.3e-19 sig 1fjj-assembly1_A-2 CRYSTAL STRUCTURE OF E.COLI YBHB PROTEIN, A NEW MEMBER OF THE MAMMALIAN PEBP FAMILY
1vi3-assembly1_A 1.00 0.96 1.0e-18 sig 1vi3-assembly1_A Crystal structure of an hypothetical protein
1fux-assembly1_B 1.00 0.94 1.2e-18 sig 1fux-assembly1_B CRYSTAL STRUCTURE OF E.COLI YBCL, A NEW MEMBER OF THE MAMMALIAN PEBP FAMILY
3n08-assembly1_B 1.00 0.87 3.5e-13 sig 3n08-assembly1_B Crystal Structure of a Putative PhosphatidylEthanolamine-Binding Protein (PEBP) Homolog CT736 from Chlamydia trachomatis D/UW-3/CX

Foldseek search of the AlphaFold DB model (mean pLDDT 96.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)pyrD (+ strand, 4 bp gap)
Downstream (3' on genome)Rv2141c (- strand, 47 bp gap)
Predicted operon TB18.6 · Rv2141c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) Rv2250c (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0708 rplP exp 50S ribosomal protein L16 867 862 experimental:784
Rv0704 rplB exp 50S ribosomal protein L2 841 836 experimental:779
Rv2890c rpsB exp 30S ribosomal protein S2 833 834 experimental:783
Rv2141c hyp hypothetical protein 832 827 ctx neighborhood:816
Rv3443c rplM exp 50S ribosomal protein L13 829 823 experimental:783
Rv0721 rpsE exp 30S ribosomal protein S5 823 823 experimental:783
Rv2785c rpsO exp 30S ribosomal protein S15 818 819 experimental:783
Rv3461c rpmJ exp 50S ribosomal protein L36 824 818 experimental:785
Rv2441c rpmA exp 50S ribosomal protein L27 825 817 experimental:787
Rv0979A rpmF exp 50S ribosomal protein L32 816 817 experimental:786
Rv2904c rplS exp 50S ribosomal protein L19 821 810 experimental:787
Rv3442c rpsI exp 30S ribosomal protein S9 809 809 experimental:785
Rv0723 rplO exp 50S ribosomal protein L15 808 809 experimental:787
Rv3456c rplQ exp 50S ribosomal protein L17 813 807 experimental:785
Rv2909c rpsP exp 30S ribosomal protein S16 809 807 experimental:785

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: YbhB/YbcL family Raf kinase inhibitor-like protein
  • Pfam (hmmscan --cut_ga): PBP PF01161.26 (E=4e-38)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216656.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PBP (PF01161.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1881
  • Curated reference: UniProt P9WFN1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.8)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 90 functional partner(s)
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002274|Rv2140c|TB18.6
MTTSPDPYAALPKLPSFSLTSTSITDGQPLATPQVSGIMGAGGADASPQLRWSGFPSETRSFAVTVYDPDAPTLSGFWHWAVANLPANVTELPEGVGDGRELPGGALTLVNDAGMRRYVGAAPPPGHGVHRYYVAVHAVKVEKLDLPEDASPAYLGFNLFQHAIARAVIFGTYEQR