cfp6 Resolved · high auto-curated

H37Rv Rv3004 · MTBC0 - · 112 aa · 3363348–3363686 (+) · RefSeq NP_217520.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)low molecular weight protein antigen 6
MTBC0 PGAP re-annotation
Revised (this work)Low molecular weight protein antigen 6. Pfam: bPH_6 (PF10756.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WIR1 SwissProt · reviewed · Evidence at protein level
UniProt nameLow molecular weight protein antigen 6

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namecfp6
eggNOG descriptionBacterial PH domain
Orthologous group2EKMU
Gene Ontology (2) GO:0005575, GO:0005576

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.22 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
bPH_6PF10756.16 1.6e-2039–109 Bacterial PH domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2520c (membrane protein), high confidence from genomic context alone (score 765 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2520c membrane protein 765 765 ctx cooccurence:764
Rv1109c hyp hypothetical protein 763 763 ctx cooccurence:761
Rv3311 hyp hypothetical protein 760 761 ctx cooccurence:759
Rv3212 hyp hypothetical protein 759 760 ctx cooccurence:759
Rv1222 rseA anti-sigma E factor RseA 753 754 ctx cooccurence:751
Rv0556 transmembrane protein 749 750 ctx cooccurence:749
Rv2980 hyp hypothetical protein 740 740 ctx cooccurence:740
Rv0010c membrane protein 740 740 ctx cooccurence:737
Rv1209 hyp hypothetical protein 737 738 ctx cooccurence:735
Rv2138 lppL lipoprotein LppL 736 736 ctx cooccurence:736
Rv3850 hyp hypothetical protein 719 719 ctx cooccurence:719
Rv2446c integral membrane protein 715 716 ctx cooccurence:713
Rv3839 hyp hypothetical protein 712 712 ctx cooccurence:712
Rv0358 hyp hypothetical protein 711 712 ctx cooccurence:711
Rv2091c membrane protein 709 710 ctx cooccurence:709

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): low molecular weight protein antigen 6
  • Pfam (hmmscan --cut_ga): bPH_6 PF10756.16 (E=2e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217520.1)
  • Domains: Pfam-A via hmmscan --cut_ga — bPH_6 (PF10756.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EKMU
  • Curated reference: UniProt P9WIR1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 95 functional partner(s); context anchor Rv2520c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3004|cfp6
MAHFAVGFLTLGLLVPVLTWPVSAPLLVIPVALSASIIRLRTLADERGVTVRTLVGSRAVRWDDIDGLRFHRGSWARATLKDGTELRLPAVTFATLPHLTEASSGRVPNPYR