pyrD Resolved · high auto-curated
H37Rv Rv2139 · MTBC0 mtbc0_002273 ·
357 aa ·
2425983–2427056 MTBC0
(+) ·
RefSeq NP_216655.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | dihydroorotate dehydrogenase |
|---|---|
| MTBC0 PGAP re-annotation | quinone-dependent dihydroorotate dehydrogenase |
| Revised (this work) | Quinone-dependent dihydroorotate dehydrogenase. Pfam: DHO_dh (PF01180.28). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (1 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Isolation of conditional expression mutants in Mycobacterium tuberculosis by transposon mutagenesis. doi:10.1016/j.tube.2011.07.004 | 2011 |
| Regulation of pyrimidine biosynthetic gene expression in bacteria: repression without repressors. doi:10.1128/MMBR.00001-08 | 2008 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -6.71 (95% CI -7.00 to -6.41). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Pyrimidine biosynthesis |
|---|---|
| Mycobrowser EC |
1.3.5.2
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2163
· 100.0% identity |
|---|---|
| M. leprae |
ML1293c
· 80.9% identity |
| M. marinum |
MMAR_3120
· 84.3% identity |
| M. smegmatis |
MSMEG_4198
· 74.9% identity |
| M. orygis |
RJtmp_002208
· 100.0% identity |
| M. abscessus |
MAB_2104c
· 70.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WHL1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Dihydroorotate dehydrogenase |
| EC (curated) |
EC 1.3.5.2
|
| Curated function | Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | pyrD |
| eggNOG description | Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor |
| Orthologous group | COG0167 |
| EC number |
EC 1.3.5.2, EC 1.3.98.1
|
| KEGG orthology |
K00226, K00254
|
| KEGG pathways |
map00240, map01100
|
| KEGG modules |
M00051
|
| Gene Ontology (6) |
GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.621 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 8 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.259 (low power)
· 5 consensus substitution(s) low power (5 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 81.9%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 10/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 59.3% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 14 in the ORF — 13 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.071, mean read count 301. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 51.6 ppm · rank 1730/3519 (50.9th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 357 aa |
|---|---|
| Molecular weight | 38.0 kDa |
| Theoretical pI | 9.96 |
| GRAVY | -0.005 (hydrophilic) |
| Aliphatic index | 101.4 |
| Aromaticity | 0.056 |
| Instability index | 40.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DHO_dh | PF01180.28 | 2.1e-95 | 49–336 | Dihydroorotate dehydrogenase |
Experimental structures (Protein Data Bank) 2 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
8ofw |
X-ray diffraction | 3.8 Å | 100% |
4xq6 |
X-ray diffraction | 2.0 Å | 91% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8ofw-assembly1_A |
1.00 | 0.99 | 8.0e-62 sig | 8ofw-assembly1_A Crystal structure of the full-length dihydroorotate dehydrogenase from Mycobacterium tuberculosis |
8ofw-assembly2_B |
1.00 | 0.99 | 9.4e-59 sig | 8ofw-assembly2_B Crystal structure of the full-length dihydroorotate dehydrogenase from Mycobacterium tuberculosis |
4xq6-assembly1_A |
1.00 | 0.96 | 2.6e-57 sig | 4xq6-assembly1_A CRYSTAL STRUCTURE OF DIHYDROOROTATE DEHYDROGENSE from MYCOBACTERIUM TUBERCULOSIS |
3zwt-assembly1_A |
1.00 | 0.89 | 2.5e-38 sig | 3zwt-assembly1_A Structure of Human Dihydroorotate Dehydrogenase with a Bound Inhibitor |
6syp-assembly1_AAA |
1.00 | 0.92 | 8.6e-38 sig | 6syp-assembly1_AAA Human DHODH bound to inhibitor IPP/CNRS-A017 |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | lppL (+ strand, 313 bp gap) |
|---|---|
| Downstream (3' on genome) | TB18.6 (- strand, 4 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1381 pyrC exp |
dihydroorotase | 995 | 990 | coexpression:858 database:900 textmining:529 |
Rv0382c pyrE exp |
orotate phosphoribosyltransferase | 990 | 979 | coexpression:734 database:900 textmining:590 |
Rv1937 exp |
oxygenase | 969 | 958 | coexpression:770 experimental:814 |
Rv0385 exp |
monooxygenase | 958 | 953 | coexpression:731 experimental:814 |
Rv1384 carB |
carbamoyl-phosphate synthase large subunit | 949 | 917 | coexpression:858 textmining:412 |
Rv1380 pyrB |
aspartate carbamoyltransferase | 960 | 913 | coexpression:857 textmining:571 |
Rv1383 carA |
carbamoyl-phosphate synthase small subunit | 929 | 908 | coexpression:849 |
Rv1385 pyrF |
orotidine 5'-phosphate decarboxylase | 945 | 881 | coexpression:861 textmining:563 |
Rv0383c ttfA hyp |
hypothetical protein | 839 | 779 | coexpression:730 |
Rv1650 pheT |
phenylalanine--tRNA ligase subunit beta | 800 | 776 | coexpression:759 |
Rv1382 hyp |
hypothetical protein | 795 | 768 | coexpression:729 |
Rv1379 pyrR |
bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase | 818 | 704 | coexpression:654 textmining:413 |
Rv3396c guaA |
GMP synthase | 807 | 586 | textmining:554 |
Rv3858c gltD |
glutamate synthase small subunit | 645 | 534 | |
Rv0886 fprB |
ferredoxin/ferredoxin--NADP reductase | 592 | 527 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: dihydroorotate dehydrogenase
- MTBC0 PGAP product: quinone-dependent dihydroorotate dehydrogenase
- Pfam (hmmscan --cut_ga): DHO_dh PF01180.28 (E=2e-95)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216655.1)
- Domains: Pfam-A via hmmscan --cut_ga — DHO_dh (PF01180.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0167 - Curated reference: UniProt P9WHL1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 80 functional partner(s)
- Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002273|Rv2139|pyrD MYPLVRRLLFLIPPEHAHKLVFAVLRGVAAVAPVRRLLRRLLGPTDPVLASTVFGVRFPAPLGLAAGFDKDGTALSSWGAMGFGYAEIGTVTAHPQPGNPAPRLFRLADDRALLNRMGFNNHGARALAIRLARHRPEIPIGVNIGKTKKTPAGDAVNDYRASARMVGPLASYLVVNVSSPNTPGLRDLQAVESLRPILSAVRAETSTPVLVKIAPDLSDSDLDDIADLAVELDLAGIVATNTTVSRDGLTTPGVDRLGPGGISGPPLAQRAVQVLRRLYDRVGDRLALISVGGIETADDAWERITAGASLLQGYTGFIYGGERWAKDIHEGIARRLHDGGFGSLHEAVGSARRRQPS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for pyrD? Email the maintainer — the message is pre-filled with this gene's details.