Rv1632c Family assigned · low

H37Rv Rv1632c · MTBC0 mtbc0_001740 · 147 aa · 1848351–1848794 MTBC0 (-) · RefSeq NP_216148.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF402 domain-containing protein
Revised (this work)DUF402; structure of the DUF402 family (PDB 2P12, TM 0.96); putative nucleotide-binding/phosphatase fold.
Functional category (TubercuList)conserved hypotheticals

In the literature (TB corpus sweep) never studied

No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.

A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

Phenotype-driven functional lead (hypothesis) priority 4.2

required for fitness in vivo (virulence / persistence factor).

Corroborating evidenceconserved / under constraint intra-MTBC; STRING-coupled to lpqW (monoacyl phosphatidylinositol tetramannoside-binding protein LpqW); structural lead available

This locus is a "hypothetical" with a conditional Tn-seq phenotype. The statement above is a working hypothesis for its functional context, synthesised from the phenotype pattern and the corroborating layers on this page (conservation, STRING coupling, operon, regulon, localisation, structure) — a prioritised requalification candidate to validate, not an established function.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): Rv1828/SigH (Rv1828 or sigH).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 0.86 (95% CI -0.23 to 2.60). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1658c · 99.3% identity
M. marinum MMAR_2436 · 73.6% identity
M. smegmatis MSMEG_3817 · 64.1% identity
M. orygis RJtmp_001706 · 93.9% identity
M. abscessus MAB_2307c · 60.4% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O06149 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDUF402 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF402)
Orthologous groupCOG2306
KEGG orthology K09146

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.506 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 81.9% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 7/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 50.5%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 11 in the ORF — 0 in the essential state, 0 growth-defect, 11 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 152.363636364. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) -1.170.0 required
fitness in mouse infection (in vivo) -1.100.043 required

Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 11 of 16 independent MS datasets
Integrated abundance35.6 ppm · rank 1982/3519 (43.7th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length147 aa
Molecular weight16.6 kDa
Theoretical pI5.53
GRAVY-0.418 (hydrophilic)
Aliphatic index82.9
Aromaticity0.109
Instability index41.0 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF402PF04167.19 5.0e-263–128 Protein of unknown function (DUF402)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 87.4 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2p12-assembly1_B 1.00 0.96 1.9e-17 sig 2p12-assembly1_B Crystal structure of protein of unknown function DUF402 from Rhodococcus sp. RHA1
3exm-assembly1_A 1.00 0.77 7.4e-05 sig 3exm-assembly1_A Crystal structure of the phosphatase SC4828 with the non-hydrolyzable nucleotide GPCP
5zdn-assembly1_A 1.00 0.63 4.8e-04 sig 5zdn-assembly1_A The complex structure of FomD with CDP
7d8q-assembly1_A 1.00 0.63 1.3e-03 sig 7d8q-assembly1_A The structure of nucleotide phosphatase Sa1684 complex with GDP analogue from Staphylococcus aureus
8rza-assembly1_A-2 1.00 0.63 3.1e-03 sig 8rza-assembly1_A-2 Ribonuclease W
8wo8-assembly1_A-3 1.00 0.63 4.6e-03 sig 8wo8-assembly1_A-3 Crystal Structure of an RNA-binding protein, FAU-1, from Pyrococcus furiosus
3ew2-assembly4_G 0.14 0.37 1.2e+00 3ew2-assembly4_G Crystal structure of rhizavidin-biotin complex
8rnu-assembly1_C 0.13 0.70 7.7e+00 8rnu-assembly1_C CryoEM structure of recombinant human Bri2 BRICHOS oligomers

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.8

PDB hitprobTM-scoreE-valueDescription
2p12-assembly1_B 1.00 0.96 2.6e-18 sig 2p12-assembly1_B Crystal structure of protein of unknown function DUF402 from Rhodococcus sp. RHA1
3exm-assembly1_A 1.00 0.82 7.5e-05 sig 3exm-assembly1_A Crystal structure of the phosphatase SC4828 with the non-hydrolyzable nucleotide GPCP
5zdn-assembly1_A 1.00 0.64 1.3e-04 sig 5zdn-assembly1_A The complex structure of FomD with CDP
8wo8-assembly1_A-3 1.00 0.67 1.7e-03 sig 8wo8-assembly1_A-3 Crystal Structure of an RNA-binding protein, FAU-1, from Pyrococcus furiosus
7d8q-assembly1_A 1.00 0.63 1.2e-03 sig 7d8q-assembly1_A The structure of nucleotide phosphatase Sa1684 complex with GDP analogue from Staphylococcus aureus

Foldseek search of the AlphaFold DB model (mean pLDDT 95.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)coaE (+ strand, 150 bp gap)
Downstream (3' on genome)uvrB (+ strand, 244 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) Rv0494 (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: lpqW (monoacyl phosphatidylinositol tetramannoside-binding protein LpqW), high confidence from genomic context alone (score 778 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 778 778 ctx cooccurence:721
Rv0556 transmembrane protein 776 776 ctx cooccurence:773
Rv2732c transmembrane protein 772 773 ctx cooccurence:772
Rv3438 hyp hypothetical protein 769 769 ctx cooccurence:768
Rv3212 hyp hypothetical protein 767 767 ctx cooccurence:765
Rv3850 hyp hypothetical protein 763 763 ctx cooccurence:761
Rv2446c integral membrane protein 759 759 ctx cooccurence:758
Rv1109c hyp hypothetical protein 758 759 ctx cooccurence:757
Rv3205c hyp hypothetical protein 751 752 ctx cooccurence:751
Rv0431 tuberculin-like peptide 750 751 ctx cooccurence:739
Rv0383c ttfA hyp hypothetical protein 743 743 ctx cooccurence:743
Rv2049c hyp hypothetical protein 740 741 ctx cooccurence:737
Rv2138 lppL lipoprotein LppL 735 736 ctx cooccurence:734
Rv2360c hyp hypothetical protein 734 735 ctx cooccurence:728
Rv0358 hyp hypothetical protein 725 725 ctx cooccurence:725

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: DUF402 domain-containing protein
  • Pfam: DUF402 PF04167.19
  • Foldseek best: 2p12-assembly1_B Crystal structure of protein of unknown function DUF402 from Rh (prob 1.00, E=2e-17, TM=0.96)
  • (structure-only promotion reviewed by hand, 2026-06-01)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216148.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF402 (PF04167.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2306
  • Curated reference: UniProt O06149 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 87.4, confident)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.8)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 94 functional partner(s); context anchor lpqW
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001740|Rv1632c|
MRAVDEYTVHPWGLYLARPTPGRAQFHYLESWLLPSLGLRATVFHFNPSHKRDHDYYLDVGEYTPGPSVWRSEDHYLDIEVRTGGGAELADVDELLDAVRHGLLTPTVAEQAVRHAVDAVEGLARNGYDLTRWLATKGMELTWRSGS