Rv1632c Family assigned · low

H37Rv Rv1632c · MTBC0 mtbc0_001740 · 147 aa · 1848351–1848794 (-) · RefSeq NP_216148.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF402 domain-containing protein
Revised (this work)DUF402; structure of the DUF402 family (PDB 2P12, TM 0.96); putative nucleotide-binding/phosphatase fold.

Curated reference (UniProt)

UniProt O06149 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDUF402 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF402)
Orthologous groupCOG2306
KEGG orthology K09146

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.506 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF402PF04167.19 5.0e-263–128 Protein of unknown function (DUF402)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 87.4 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2p12-assembly1_B 1.00 0.96 1.9e-17 sig 2p12-assembly1_B Crystal structure of protein of unknown function DUF402 from Rhodococcus sp. RHA1
3exm-assembly1_A 1.00 0.77 7.4e-05 sig 3exm-assembly1_A Crystal structure of the phosphatase SC4828 with the non-hydrolyzable nucleotide GPCP
5zdn-assembly1_A 1.00 0.63 4.8e-04 sig 5zdn-assembly1_A The complex structure of FomD with CDP
7d8q-assembly1_A 1.00 0.63 1.3e-03 sig 7d8q-assembly1_A The structure of nucleotide phosphatase Sa1684 complex with GDP analogue from Staphylococcus aureus
8rza-assembly1_A-2 1.00 0.63 3.1e-03 sig 8rza-assembly1_A-2 Ribonuclease W
8wo8-assembly1_A-3 1.00 0.63 4.6e-03 sig 8wo8-assembly1_A-3 Crystal Structure of an RNA-binding protein, FAU-1, from Pyrococcus furiosus
3ew2-assembly4_G 0.14 0.37 1.2e+00 3ew2-assembly4_G Crystal structure of rhizavidin-biotin complex
8rnu-assembly1_C 0.13 0.70 7.7e+00 8rnu-assembly1_C CryoEM structure of recombinant human Bri2 BRICHOS oligomers

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lpqW (monoacyl phosphatidylinositol tetramannoside-binding protein LpqW), high confidence from genomic context alone (score 778 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 778 778 ctx cooccurence:721
Rv0556 transmembrane protein 776 776 ctx cooccurence:773
Rv2732c transmembrane protein 772 773 ctx cooccurence:772
Rv3438 hyp hypothetical protein 769 769 ctx cooccurence:768
Rv3212 hyp hypothetical protein 767 767 ctx cooccurence:765
Rv3850 hyp hypothetical protein 763 763 ctx cooccurence:761
Rv2446c integral membrane protein 759 759 ctx cooccurence:758
Rv1109c hyp hypothetical protein 758 759 ctx cooccurence:757
Rv3205c hyp hypothetical protein 751 752 ctx cooccurence:751
Rv0431 tuberculin-like peptide 750 751 ctx cooccurence:739
Rv0383c ttfA hyp hypothetical protein 743 743 ctx cooccurence:743
Rv2049c hyp hypothetical protein 740 741 ctx cooccurence:737
Rv2138 lppL lipoprotein LppL 735 736 ctx cooccurence:734
Rv2360c hyp hypothetical protein 734 735 ctx cooccurence:728
Rv0358 hyp hypothetical protein 725 725 ctx cooccurence:725

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: DUF402 domain-containing protein
  • Pfam: DUF402 PF04167.19
  • Foldseek best: 2p12-assembly1_B Crystal structure of protein of unknown function DUF402 from Rh (prob 1.00, E=2e-17, TM=0.96)
  • (structure-only promotion reviewed by hand, 2026-06-01)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216148.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF402 (PF04167.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2306
  • Curated reference: UniProt O06149 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 87.4, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 94 functional partner(s); context anchor lpqW
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001740|Rv1632c|
MRAVDEYTVHPWGLYLARPTPGRAQFHYLESWLLPSLGLRATVFHFNPSHKRDHDYYLDVGEYTPGPSVWRSEDHYLDIEVRTGGGAELADVDELLDAVRHGLLTPTVAEQAVRHAVDAVEGLARNGYDLTRWLATKGMELTWRSGS