parE2 Family assigned · medium auto-curated

H37Rv Rv2142c · MTBC0 mtbc0_002277 · 105 aa · 2429572–2429889 MTBC0 (-) · RefSeq NP_216658.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv2129c (Rv2129c) — family_assigned: SDR family oxidoreductase mshC (Rv2130c) — requalified: cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyra mshC cysQ (Rv2131c) — requalified: 3'(2')%2C5'-bisphosphate nucleotidase CysQ Rv2132 (Rv2132) — family_assigned: ribbon-helix-helix protein%2C CopG family Rv2133c (Rv2133c) — family_assigned: SCO1664 family protein Rv2135c (Rv2135c) — family_assigned: histidine phosphatase family protein Rv2136c (Rv2136c) — requalified: undecaprenyl-diphosphate phosphatase Rv2136c lppL (Rv2138) — family_assigned: hypothetical protein lppL pyrD (Rv2139) — requalified: quinone-dependent dihydroorotate dehydrogenase pyrD TB18.6 (Rv2140c) — family_assigned: YbhB/YbcL family Raf kinase inhibitor-like protein parE2 (Rv2142c) — family_assigned: type II toxin-antitoxin system RelE/ParE family toxin Rv2143 (Rv2143) — family_assigned: phosphoribosyltransferase family protein Rv2143 Rv2144c (Rv2144c) — dark: hypothetical protein wag31 (Rv2145c) — requalified: cell wall synthesis protein Wag31 Rv2146c (Rv2146c) — family_assigned: YggT family protein Rv2148c (Rv2148c) — family_assigned: YggS family pyridoxal phosphate-dependent enzyme ftsZ (Rv2150c) — requalified: cell division protein FtsZ ftsZ ftsQ (Rv2151c) — requalified: cell division protein FtsQ ftsQ murC (Rv2152c) — requalified: UDP-N-acetylmuramate--L-alanine ligase murC murG (Rv2153c) — requalified: undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylgluc murG ftsW (Rv2154c) — family_assigned: putative lipid II flippase FtsW ftsW 2 420 kb 2 424 kb 2 428 kb 2 432 kb 2 436 kb 2 440 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)toxin ParE2
MTBC0 PGAP re-annotationtype II toxin-antitoxin system RelE/ParE family toxin
Revised (this work)Type II toxin-antitoxin system RelE/ParE family toxin. Pfam: ParE_toxin (PF05016.22).
Functional category (TubercuList)virulence, detoxification, adaptation

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).

PublicationDate
The Chromosomal parDE2 Toxin-Antitoxin System of Mycobacterium tuberculosis H37Rv: Genetic and Functional Characterization. doi:10.3389/fmicb.2016.00886 2016

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene

NeighbourRv2142A (Rv2142A, - strand)
Overlap4 bp, 1 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 1.17 (95% CI -0.48 to 3.96). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2166c · 100.0% identity
M. orygis RJtmp_002212 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WHG5 SwissProt · reviewed · Evidence at protein level
UniProt nameToxin ParE2
Curated functionToxic component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli inhibits cell growth and colony formation. Its toxic effect is neutralized by coexpression with cognate antitoxin ParD2.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category D Cell cycle control, cell division, chromosome partitioning
eggNOG descriptionPlasmid stabilization system
Orthologous groupCOG3668
KEGG orthology K19093
Gene Ontology (6) GO:0008150, GO:0040008, GO:0045926, GO:0048519, GO:0050789, GO:0065007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.21% of strains (302) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) MTBC-specific

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 0/53 (0%) · 0/4 closest MTBAP relatives
absent from ALL 53 non-MTBC Mycobacterium genomes tested (incl. the closest MTBAP relatives) — a candidate MTBC-specific genetic innovation / host-adaptation factor (confirm by synteny; rule out a short/low-complexity ORF and extreme divergence)
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

absent from the whole genus and from all outgroups tested — a candidate MTBC-specific innovation (confirm by synteny; rule out detection failure for short/divergent ORFs)

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 13 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 13 growth-advantage. Saturation 1.000, mean read count 293. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 11 of 16 independent MS datasets
Integrated abundance138.0 ppm · rank 1064/3519 (69.8th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length105 aa
Molecular weight12.3 kDa
Theoretical pI6.06
GRAVY-0.415 (hydrophilic)
Aliphatic index80.0
Aromaticity0.143
Instability index45.6 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ParE_toxinPF05016.22 4.9e-076–91 ParE toxin of type II toxin-antitoxin system, parDE

Experimental structures (Protein Data Bank) 1 solved

PDBMethodResolutionCoverage
8c26 X-ray diffraction 2.35 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.5

PDB hitprobTM-scoreE-valueDescription
8c26-assembly1_A 1.00 0.98 2.1e-15 sig 8c26-assembly1_A ParDE2 toxin-antitoxin complex from Mycobacterium tuberculosis (rv2142A-rv2142c)
5cze-assembly1_J 1.00 0.85 4.2e-06 sig 5cze-assembly1_J Crystal structure of the PaaA2-ParE2 antitoxin-toxin complex
5czf-assembly2_C 1.00 0.83 4.8e-06 sig 5czf-assembly2_C Crystal structure of the PaaA2-ParE2 antitoxin-toxin complex
6xrw-assembly2_C 1.00 0.78 4.7e-04 sig 6xrw-assembly2_C Chromosomal ParDE TA system from P. aeruginosa
5ceg-assembly1_B 1.00 0.71 2.9e-04 sig 5ceg-assembly1_B X-ray structure of toxin/anti-toxin complex from Mesorhizobium opportunistum

Foldseek search of the AlphaFold DB model (mean pLDDT 92.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)leuU (+ strand, 120 bp gap)
Downstream (3' on genome)parD2 (- strand, -4 bp gap)
Predicted operon parE2 · parD2

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: parD2 (antitoxin ParD2), high confidence from genomic context alone (score 882 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2142A parD2 antitoxin ParD2 976 882 ctx neighborhood:882 textmining:806
Rv2143 hyp hypothetical protein 470 470 ctx neighborhood:467
Rv1959c parE1 toxin ParE1 876 87 textmining:870
Rv1960c parD1 antitoxin ParD1 804 50 textmining:803
Rv1603 hisA 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 654 47 textmining:652

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: toxin ParE2
  • MTBC0 PGAP product: type II toxin-antitoxin system RelE/ParE family toxin
  • Pfam (hmmscan --cut_ga): ParE_toxin PF05016.22 (E=5e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216658.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ParE_toxin (PF05016.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3668
  • Curated reference: UniProt P9WHG5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.5)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 5 functional partner(s); context anchor parD2
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002277|Rv2142c|parE2
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAIDILAVRHGMENPNAVEAEISGRTFE