mshC Resolved · high auto-curated

H37Rv Rv2130c · MTBC0 mtbc0_002263 · 414 aa · 2418478–2419722 MTBC0 (-) · RefSeq NP_216646.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase
MTBC0 PGAP re-annotationcysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase
Revised (this work)Cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase. Pfam: tRNA-synt_1e (PF01406.26).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 30 publications

30 TB publications mention this gene. 30 publication(s) discuss this gene (21 in a M. tuberculosis context, 16 in other mycobacteria — M. smegmatis (16), M. abscessus (1)).

Most recent 5 of 30.
PublicationDate
Pharmacological targeting of the mycothiol cysteine ligase MshC in Mycobacteriumabscessus. doi:10.1016/j.jbc.2026.111433 2026
Synthesis and inhibition studies of substrate analogues for MshC (cysteine ligase) enzyme in Mycobacterium tuberculosis. doi:10.1016/j.carres.2025.109652 2025
Unravelling the genetic contributors to linezolid resistance in Mycobacterium smegmatis: insights from a transposon library. doi:10.1093/jac/dkaf106 2025
Structural Basis of Cysteine Ligase MshC Inhibition by Cysteinyl-Sulfonamides. doi:10.3390/ijms232315095 2022
Synthesis of substrate analogues as potential inhibitors for Mycobacterium tuberculosis enzyme MshC. doi:10.1016/j.carres.2017.10.014 2017

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -1.85 (95% CI -2.05 to -1.62). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in the third step of mycothiol biosynthesis
Mycobrowser EC 6.1.1.16 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2154c · 100.0% identity
M. leprae ML1302 · 85.1% identity
M. marinum MMAR_3110 · 83.6% identity
M. smegmatis MSMEG_4189 · 79.0% identity
M. orygis RJtmp_002198 · 100.0% identity
M. abscessus MAB_2116 · 74.9% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WJM9 SwissProt · reviewed · Evidence at protein level
UniProt nameL-cysteine:1D-myo-inositol 2-amino-2-deoxy-alpha-D-glucopyranoside ligase
EC (curated) EC 6.3.1.13
Curated functionCatalyzes the ATP-dependent condensation of GlcN-Ins and L-cysteine to form L-Cys-GlcN-Ins.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namemshC
eggNOG descriptionCatalyzes the ATP-dependent condensation of GlcN-Ins and L-cysteine to form L-Cys-GlcN-Ins
Orthologous groupCOG0215
EC number EC 6.1.1.16, EC 6.3.1.13
KEGG orthology K01883, K15526
KEGG pathways map00970
KEGG modules M00359, M00360
Gene Ontology (95) GO:0000166, GO:0003674, GO:0003824, GO:0004812, GO:0004817, GO:0005488, GO:0005524, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829 +83 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.555 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.083 (low power) · 6 consensus substitution(s)
low power (6 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 83.3% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 54.7%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) GD — not strictly essential

DeJesus 2017 callGD · growth-defect
What the call meansgrowth-defect: insertions tolerated but fitness reduced; NOT essential
TA sites (Himar1) 25 in the ORF — 0 in the essential state, 24 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.640, mean read count 4.3125. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
Caveat`essential: true` here is the broad union (ES+ESD+GD) kept for backward compatibility; this gene is NOT strictly essential. Read n_sites_* before writing anything about essentiality.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain validated drug target

This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.

Hypomorph strainmshC-tetOn18 (TetON promoter 18)
Baseline knockdown fitness4.246 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown
Used in target deconvolutionyes (informs phenotypic-cluster / MOA assignment)
Drug-target cross-referenceannotated mechanism-of-action target MshC: 1 reference compound(s) phenocopy its inhibition — chemically-validated druggable target

Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
Mutants exhibiting altered fitness in the absence of gene marP (other) -6.500.0 required
Differential genetic requirements of clinical Mtb strain (ID=630) from Euro-American lineage (compared to H37Rv control) (strain background) -3.590.021 required
Differential genetic requirements of clinical Mtb strain (ID=641) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) -3.340.0096 required
Mutants exhibiting altered fitness in the absence of gene PE35 (other) +3.180.0 disruption advantageous
Differential genetic requirements of clinical Mtb strain (ID=631) from East Asian lineage (compared to H37Rv control) (strain background) -2.540.014 required
Differential genetic requirements of clinical Mtb strain (ID=663) from Euro-American lineage (compared to H37Rv control) (strain background) -2.120.021 required
Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) -2.000.0 required
fitness in mouse infection (in vivo) +1.120.016 disruption advantageous

Conditional fitness of transposon-disruption mutants across 8 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 15 of 16 independent MS datasets
Integrated abundance109.0 ppm · rank 1233/3519 (65.0th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length414 aa
Molecular weight45.6 kDa
Theoretical pI5.24
GRAVY-0.211 (hydrophilic)
Aliphatic index86.1
Aromaticity0.087
Instability index49.1 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
tRNA-synt_1ePF01406.26 5.0e-8336–338 tRNA synthetases class I (C) catalytic domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.3

PDB hitprobTM-scoreE-valueDescription
3c8z-assembly1_A 1.00 1.00 7.3e-68 sig 3c8z-assembly1_A The 1.6 A Crystal Structure of MshC: The Rate Limiting Enzyme in the Mycothiol Biosynthetic Pathway
8hfm-assembly1_A 1.00 0.99 7.0e-67 sig 8hfm-assembly1_A Crystal Structure of Mycobacterium smegmatis MshC
8hfo-assembly1_A 1.00 0.98 3.5e-65 sig 8hfo-assembly1_A Crystal Structure of Mycobacterium smegmatis MshC in Complex with Compound 7d
3tqo-assembly1_A 1.00 0.89 1.2e-33 sig 3tqo-assembly1_A Structure of the cysteinyl-tRNA synthetase (cysS) from Coxiella burnetii.
1u0b-assembly1_B 1.00 0.85 1.6e-33 sig 1u0b-assembly1_B Crystal structure of cysteinyl-tRNA synthetase binary complex with tRNACys

Foldseek search of the AlphaFold DB model (mean pLDDT 96.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv2129c (- strand, 25 bp gap)
Downstream (3' on genome)cysQ (- strand, 57 bp gap)
Predicted operon Rv2129c · mshC

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: cysQ (3'(2'),5'-bisphosphate nucleotidase CysQ), high confidence from genomic context alone (score 814 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2131c cysQ 3'(2'),5'-bisphosphate nucleotidase CysQ 823 814 ctx neighborhood:805
Rv2335 cysE serine acetyltransferase 816 792 coexpression:720
Rv0819 mshD exp mycothiol acetyltransferase 989 777 ctx cooccurence:549 database:500 textmining:955
Rv2133c hyp hypothetical protein 748 738 ctx neighborhood:544 cooccurence:416
Rv2134c hyp hypothetical protein 723 723 ctx neighborhood:544
Rv2129c oxidoreductase 721 721 ctx neighborhood:707
Rv1170 mshB exp 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase 986 704 database:500 textmining:955
Rv1976c hyp hypothetical protein 706 700 coexpression:683
Rv2614c thrS threonine--tRNA ligase 726 690 ctx cooccurence:594
Rv2466c hyp hypothetical protein 694 683 ctx cooccurence:666
Rv2135c hyp hypothetical protein 675 676 ctx neighborhood:544
Rv2555c alaS alanine--tRNA ligase 707 668 coexpression:417
Rv3834c serS serine--tRNA ligase 653 606 ctx cooccurence:471
Rv1082 mca mycothiol S-conjugate amidase 941 594 ctx cooccurence:563 textmining:862
Rv0041 leuS leucine--tRNA ligase 634 585 coexpression:415

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cysteine:1D-myo-inosityl 2-amino-2-deoxy--D-glucopyranoside ligase
  • MTBC0 PGAP product: cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase
  • Pfam (hmmscan --cut_ga): tRNA-synt_1e PF01406.26 (E=5e-83)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216646.1)
  • Domains: Pfam-A via hmmscan --cut_ga — tRNA-synt_1e (PF01406.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0215
  • Curated reference: UniProt P9WJM9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 82 functional partner(s); context anchor cysQ
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002263|Rv2130c|mshC
MQSWYCPPVPVLPGRGPQLRLYDSADRQVRPVAPGSKATMYVCGITPYDATHLGHAATYVTFDLIHRLWLDLGHELHYVQNITDIDDPLFERADRDGVDWRDLAQAEVALFCEDMAALRVLPPQDYVGATEAIAEMVELIEKMLACGAAYVIDREMGEYQDIYFRADATLQFGYESGYDRDTMLRLCEERGGDPRRPGKSDELDALLWRAARPGEPSWPSPFGPGRPGWHVECAAIALSRIGSGLDIQGGGSDLIFPHHEFTAAHAECVSGERRFARHYVHAGMIGWDGHKMSKSRGNLVLVSALRAQDVEPSAVRLGLLAGHYRADRFWSQQVLDEATARLHRWRTATALPAGPAAVDVVARVRRYLADDLDTPKAIAALDGWVTDAVEYGGHDAGAPKLVATAIDALLGVDL