Rv1081c Still unknown · low auto-curated

H37Rv Rv1081c · MTBC0 mtbc0_001161 · 144 aa · 1214253–1214687 (-) · RefSeq NP_215597.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationDUF4307 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF4307. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53429 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF4307)
Orthologous group2DRBP

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4307PF14155.12 2.3e-3623–133 Domain of unknown function (DUF4307)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mca (mycothiol S-conjugate amidase), high confidence from genomic context alone (score 780 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1083 hyp hypothetical protein 889 889 ctx neighborhood:780 cooccurence:515
Rv1084 hyp hypothetical protein 781 781 ctx neighborhood:780
Rv1082 mca mycothiol S-conjugate amidase 780 780 ctx neighborhood:780
Rv2138 lppL lipoprotein LppL 768 769 ctx cooccurence:767
Rv0556 transmembrane protein 752 752 ctx cooccurence:751
Rv2732c transmembrane protein 703 703 ctx cooccurence:703
Rv3438 hyp hypothetical protein 702 702 ctx cooccurence:702
Rv0513 transmembrane protein 687 688 ctx cooccurence:687
Rv1632c hyp hypothetical protein 675 676 ctx cooccurence:672
Rv3212 hyp hypothetical protein 674 674 ctx cooccurence:672
Rv0996 transmembrane protein 664 665 ctx cooccurence:663
Rv0784 hyp hypothetical protein 649 649 ctx cooccurence:647
Rv0358 hyp hypothetical protein 647 647 ctx cooccurence:646
Rv3205c hyp hypothetical protein 644 644 ctx cooccurence:644
Rv2049c hyp hypothetical protein 643 643 ctx cooccurence:641

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: DUF4307 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF4307 PF14155.12 (E=2e-36)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215597.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4307 (PF14155.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DRBP
  • Curated reference: UniProt O53429 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 52 functional partner(s); context anchor mca
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001161|Rv1081c|
MTHTPIPRPDARYGRPRLSRRARRRVAIALGVLVAAAGIVIAVIGYQRISTSAVTGSLVGYRLVDDETASVTISVTRSDPSRPVACIVRVRATNGSETGRRELLVPPSEATTVQVTTTVKSSQPPVMADVYGCGTEVPSYLRLP