Rv1081c Still unknown · low auto-curated
H37Rv Rv1081c · MTBC0 mtbc0_001161 ·
144 aa · 1214253–1214687 (-) ·
RefSeq NP_215597.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | membrane protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF4307 domain-containing protein |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF4307. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53429
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable conserved membrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Domain of unknown function (DUF4307) |
| Orthologous group | 2DRBP |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF4307 | PF14155.12 | 2.3e-36 | 23–133 | Domain of unknown function (DUF4307) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mca (mycothiol S-conjugate amidase), high confidence from genomic context alone (score 780 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1083 hyp |
hypothetical protein | 889 | 889 ctx | neighborhood:780 cooccurence:515 |
Rv1084 hyp |
hypothetical protein | 781 | 781 ctx | neighborhood:780 |
Rv1082 mca |
mycothiol S-conjugate amidase | 780 | 780 ctx | neighborhood:780 |
Rv2138 lppL |
lipoprotein LppL | 768 | 769 ctx | cooccurence:767 |
Rv0556 |
transmembrane protein | 752 | 752 ctx | cooccurence:751 |
Rv2732c |
transmembrane protein | 703 | 703 ctx | cooccurence:703 |
Rv3438 hyp |
hypothetical protein | 702 | 702 ctx | cooccurence:702 |
Rv0513 |
transmembrane protein | 687 | 688 ctx | cooccurence:687 |
Rv1632c hyp |
hypothetical protein | 675 | 676 ctx | cooccurence:672 |
Rv3212 hyp |
hypothetical protein | 674 | 674 ctx | cooccurence:672 |
Rv0996 |
transmembrane protein | 664 | 665 ctx | cooccurence:663 |
Rv0784 hyp |
hypothetical protein | 649 | 649 ctx | cooccurence:647 |
Rv0358 hyp |
hypothetical protein | 647 | 647 ctx | cooccurence:646 |
Rv3205c hyp |
hypothetical protein | 644 | 644 ctx | cooccurence:644 |
Rv2049c hyp |
hypothetical protein | 643 | 643 ctx | cooccurence:641 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: membrane protein
- MTBC0 PGAP product: DUF4307 domain-containing protein
- Pfam (hmmscan --cut_ga): DUF4307 PF14155.12 (E=2e-36)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215597.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF4307 (PF14155.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DRBP - Curated reference: UniProt O53429 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
52 functional partner(s); context anchor
mca - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001161|Rv1081c| MTHTPIPRPDARYGRPRLSRRARRRVAIALGVLVAAAGIVIAVIGYQRISTSAVTGSLVGYRLVDDETASVTISVTRSDPSRPVACIVRVRATNGSETGRRELLVPPSEATTVQVTTTVKSSQPPVMADVYGCGTEVPSYLRLP