Rv1954c Still unknown · low auto-curated

H37Rv Rv1954c · MTBC0 mtbc0_002069 · 173 aa · 2220339–2220860 (-) · RefSeq NP_216470.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 3g02-assembly1_A Structure of enantioselective mutant of epoxide hydro (prob 0.04, TM 0.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLQ3 SwissProt · reviewed · Evidence at transcript level
UniProt nameUncharacterized protein Rv1954c

UniProt still lists this protein as Uncharacterized protein Rv1954c; the revised annotation above is ahead of the current UniProt record.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.501 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 39.3 (very low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
3g02-assembly1_A 0.04 0.24 1.1e+00 3g02-assembly1_A Structure of enantioselective mutant of epoxide hydrolase from Aspergillus niger generated by directed evolution
3g02-assembly1_B 0.04 0.24 1.4e+00 3g02-assembly1_B Structure of enantioselective mutant of epoxide hydrolase from Aspergillus niger generated by directed evolution
1qo7-assembly1_A 0.03 0.25 1.6e+00 1qo7-assembly1_A Structure of Aspergillus niger epoxide hydrolase
6n04-assembly1_A 0.02 0.38 8.1e+00 6n04-assembly1_A The X-ray crystal structure of AbsH3, an FAD dependent reductase from the Abyssomicin biosynthesis pathway in Streptomyces
5nff-assembly12_L 0.01 0.20 3.6e+00 5nff-assembly12_L Crystal structure of GP1 receptor binding domain from Morogoro virus

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv2660c hyp hypothetical protein 641 70 textmining:630
Rv1955 higB toxin HigB 527 70 textmining:513
Rv1374c hyp hypothetical protein 521 55 textmining:514
Rv1957 secBL SecB-like chaperone 524 52 textmining:519
Rv3288c usfY hyp hypothetical protein 633 49 textmining:630
Rv0188 transmembrane protein 483 47 textmining:480
Rv3661 hyp hypothetical protein 441 42 textmining:441
Rv0061c hyp hypothetical protein 652 41 textmining:652
Rv1954A Rv1954A, len: 100 aa. Hypothetical unknown protein. 540 41 textmining:540
Rv3182 higB3 hyp hypothetical protein 410 41 textmining:410

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 3g02-assembly1_A Structure of enantioselective mutant of epoxide hydrolase from (prob 0.04, E=1e+00, TM=0.24)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216470.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt P9WLQ3 (SwissProt, reviewed; Evidence at transcript level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 39.3, very low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002069|Rv1954c|
MAAGSGGGTVGLVLPRVASLSGLDGAPTVPEGSDKALMHLGDPPRRCDTHPDGTSSAAAALVLRRIDVHPLLTGLGRGRQTVSLRNGHLVATANRAILSRRRSRLTRGRSFTSHLITSCPRLDDHQHRHPTRCRAEHAGCTVATCIPNAHDPAPGHQTPRWGPFRLKPAYTRI