ephB Resolved · high auto-curated

H37Rv Rv1938 · MTBC0 mtbc0_002052 · 356 aa · 2210143–2211213 (+) · RefSeq NP_216454.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)epoxide hydrolase EphB
MTBC0 PGAP re-annotationepoxide hydrolase EphB
Revised (this work)Epoxide hydrolase EphB. Pfam: Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16), Abhydrolase_6 (PF12697.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YC03 SwissProt · reviewed · Evidence at protein level
UniProt nameEpoxide hydrolase B
EC (curated) EC 3.3.2.10
Curated functionCould be involved in detoxification of extraneous host-cell epoxides. Catalyzes the hydrolysis of epoxide-containing substrates.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameephB
eggNOG descriptionAlpha beta hydrolase
Orthologous groupCOG0596
Gene Ontology (12) GO:0003674, GO:0003824, GO:0004301, GO:0005488, GO:0005515, GO:0016787, GO:0016801, GO:0016803, GO:0018742, GO:0042802, GO:0042803, GO:0046983

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.952 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 9 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Abhydrolase_1PF00561.27 3.6e-2928–129 alpha/beta hydrolase fold
Hydrolase_4PF12146.16 6.2e-1429–128 Serine aminopeptidase, S33
Abhydrolase_6PF12697.14 1.4e-1330–165 Alpha/beta hydrolase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1937 (oxygenase), high confidence from genomic context alone (score 982 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1937 oxygenase 983 982 ctx neighborhood:774 cooccurence:437 coexpression:864
Rv1939 oxidoreductase 968 968 ctx neighborhood:786 coexpression:858
Rv1940 ribA1 riboflavin biosynthesis protein RibA 967 966 ctx neighborhood:787 coexpression:846
Rv1936 monooxygenase 977 962 ctx neighborhood:769 coexpression:799 textmining:434
Rv1941 short-chain type dehydrogenase/reductase 815 815 ctx neighborhood:787
Rv1934c fadE17 acyl-CoA dehydrogenase FadE17 592 592 ctx neighborhood:450
Rv1833c dhmA2 haloalkane dehalogenase 560 561 ctx cooccurence:558
Rv1935c echA13 enoyl-CoA hydratase EchA13 552 552 ctx neighborhood:464
Rv1933c fadE18 acyl-CoA dehydrogenase FadE18 537 537 ctx neighborhood:450
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 530 502 experimental:441
Rv2940c mas multifunctional mycocerosic acid synthase 527 500 experimental:441
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 527 500 experimental:441
Rv2048c pks12 polyketide synthase 526 498 experimental:441
Rv1527c pks5 polyketide synthase 526 498 experimental:441
Rv2946c pks1 polyketide synthase 486 455

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: epoxide hydrolase EphB
  • MTBC0 PGAP product: epoxide hydrolase EphB
  • Pfam (hmmscan --cut_ga): Abhydrolase_1 PF00561.27 (E=4e-29), Hydrolase_4 PF12146.16 (E=6e-14), Abhydrolase_6 PF12697.14 (E=1e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216454.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16), Abhydrolase_6 (PF12697.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0596
  • Curated reference: UniProt I6YC03 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 41 functional partner(s); context anchor Rv1937
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002052|Rv1938|ephB
MSQVHRILNCRGTRIHAVADSPPDQQGPLVVLLHGFPESWYSWRHQIPALAGAGYRVVAIDQRGYGRSSKYRVQKAYRIKELVGDVVGVLDSYGAEQAFVVGHDWGAPVAWTFAWLHPDRCAGVVGISVPFAGRGVIGLPGSPFGERRPSDYHLELAGPGRVWYQDYFAVQDGIITEIEEDLRGWLLGLTYTVSGEGMMAATKAAVDAGVDLESMDPIDVIRAGPLCMAEGARLKDAFVYPETMPAWFTEADLDFYTGEFERSGFGGPLSFYHNIDNDWHDLADQQGKPLTPPALFIGGQYDVGTIWGAQAIERAHEVMPNYRGTHMIADVGHWIQQEAPEETNRLLLDFLGGLRP