ephB Resolved · high auto-curated
H37Rv Rv1938 · MTBC0 mtbc0_002052 ·
356 aa ·
2210143–2211213 MTBC0
(+) ·
RefSeq NP_216454.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | epoxide hydrolase EphB |
|---|---|
| MTBC0 PGAP re-annotation | epoxide hydrolase EphB |
| Revised (this work) | Epoxide hydrolase EphB. Pfam: Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16), Abhydrolase_6 (PF12697.14). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 3 publications
3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Cavities create a potential back door in epoxide hydrolase Rv1938 from Mycobacterium tuberculosis-A molecular dynamics simulation study. doi:10.1016/j.compbiolchem.2015.07.008 | 2015 |
| The structure-activity relationship of urea derivatives as anti-tuberculosis agents. doi:10.1016/j.bmc.2011.07.034 | 2011 |
| Cloning, expression, purification, crystallization and preliminary X-ray studies of epoxide hydrolases A and B from Mycobacterium tuberculosis. doi:10.1107/S1744309106000637 | 2006 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | Rv1939 (Rv1939, + strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.95 (95% CI -2.61 to 6.09). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | This enzyme acts on epoxides (alkene oxides, oxiranes) and arene oxides. Plays a role in xenobiotic metabolism by degrading potential toxic epoxides. Also determines steady-state levels of physiological mediators. |
|---|---|
| Mycobrowser EC |
3.3.2.3
· superseded EC numbering; the atlas uses the current class (3.3.2.10)
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1973
· 99.7% identity |
|---|---|
| M. marinum |
MMAR_2866
· 86.8% identity |
| M. orygis |
RJtmp_002011
· 99.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
I6YC03
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Epoxide hydrolase B |
| EC (curated) |
EC 3.3.2.10
|
| Curated function | Could be involved in detoxification of extraneous host-cell epoxides. Catalyzes the hydrolysis of epoxide-containing substrates. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | ephB |
| eggNOG description | Alpha beta hydrolase |
| Orthologous group | COG0596 |
| Gene Ontology (12) |
GO:0003674, GO:0003824, GO:0004301, GO:0005488, GO:0005515, GO:0016787, GO:0016801, GO:0016803, GO:0018742, GO:0042802, GO:0042803, GO:0046983
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.952 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 9 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 56.4%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 5/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 35.7% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 17 in the ORF — 0 in the essential state, 0 growth-defect, 17 non-essential, 0 growth-advantage. Saturation 0.882, mean read count 56.4. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 15 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 70.5 ppm · rank 1524/3519 (56.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 356 aa |
|---|---|
| Molecular weight | 39.3 kDa |
| Theoretical pI | 5.05 |
| GRAVY | -0.178 (hydrophilic) |
| Aliphatic index | 82.8 |
| Aromaticity | 0.112 |
| Instability index | 40.5 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Abhydrolase_1 | PF00561.27 | 3.6e-29 | 28–129 | alpha/beta hydrolase fold |
Hydrolase_4 | PF12146.16 | 6.2e-14 | 29–128 | Serine aminopeptidase, S33 |
Abhydrolase_6 | PF12697.14 | 1.4e-13 | 30–165 | Alpha/beta hydrolase family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2e3j-assembly1_A |
1.00 | 1.00 | 1.4e-68 sig | 2e3j-assembly1_A The crystal structure of epoxide hydrolase B (Rv1938) from mycobacterium tuberculosis at 2.1 angstrom |
6unw-assembly1_A |
1.00 | 0.92 | 2.5e-37 sig | 6unw-assembly1_A Epoxide hydrolase from an endophytic Streptomyces |
7cg6-assembly1_B |
1.00 | 0.91 | 4.0e-28 sig | 7cg6-assembly1_B Vigna radiata Epoxide hydrolase mutant M263Q |
5xmd-assembly1_A |
1.00 | 0.87 | 2.1e-27 sig | 5xmd-assembly1_A Crystal structure of epoxide hydrolase VrEH1 from Vigna radiata |
6hgv-assembly1_A |
1.00 | 0.85 | 1.3e-27 sig | 6hgv-assembly1_A Soluble epoxide hydrolase in complex with talinolol |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 6
| Upstream (5' on genome) | Rv1937 (+ strand, 11 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1939 (+ strand, -4 bp gap) |
| Predicted operon |
Rv1936 · Rv1937 · ephB · Rv1939 · ribA1 · Rv1941
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (3 TF) |
Rv0023 (represses) · Rv0081 (activates) · Rv0324 (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv1937 (oxygenase), high confidence from genomic context alone (score 982 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1937 |
oxygenase | 983 | 982 ctx | neighborhood:774 cooccurence:437 coexpression:864 |
Rv1939 |
oxidoreductase | 968 | 968 ctx | neighborhood:786 coexpression:858 |
Rv1940 ribA1 |
riboflavin biosynthesis protein RibA | 967 | 966 ctx | neighborhood:787 coexpression:846 |
Rv1936 |
monooxygenase | 977 | 962 ctx | neighborhood:769 coexpression:799 textmining:434 |
Rv1941 |
short-chain type dehydrogenase/reductase | 815 | 815 ctx | neighborhood:787 |
Rv1934c fadE17 |
acyl-CoA dehydrogenase FadE17 | 592 | 592 ctx | neighborhood:450 |
Rv1833c dhmA2 |
haloalkane dehalogenase | 560 | 561 ctx | cooccurence:558 |
Rv1935c echA13 |
enoyl-CoA hydratase EchA13 | 552 | 552 ctx | neighborhood:464 |
Rv1933c fadE18 |
acyl-CoA dehydrogenase FadE18 | 537 | 537 ctx | neighborhood:450 |
Rv3825c pks2 exp |
phthioceranic/hydroxyphthioceranic acid synthase | 530 | 502 | experimental:441 |
Rv2940c mas exp |
multifunctional mycocerosic acid synthase | 527 | 500 | experimental:441 |
Rv2933 ppsC exp |
phthiocerol synthesis polyketide synthase type I PpsC | 527 | 500 | experimental:441 |
Rv2048c pks12 exp |
polyketide synthase | 526 | 498 | experimental:441 |
Rv1527c pks5 exp |
polyketide synthase | 526 | 498 | experimental:441 |
Rv2946c pks1 |
polyketide synthase | 486 | 455 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: epoxide hydrolase EphB
- MTBC0 PGAP product: epoxide hydrolase EphB
- Pfam (hmmscan --cut_ga): Abhydrolase_1 PF00561.27 (E=4e-29), Hydrolase_4 PF12146.16 (E=6e-14), Abhydrolase_6 PF12697.14 (E=1e-13)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216454.1)
- Domains: Pfam-A via hmmscan --cut_ga — Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16), Abhydrolase_6 (PF12697.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0596 - Curated reference: UniProt I6YC03 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
41 functional partner(s); context anchor
Rv1937 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002052|Rv1938|ephB MSQVHRILNCRGTRIHAVADSPPDQQGPLVVLLHGFPESWYSWRHQIPALAGAGYRVVAIDQRGYGRSSKYRVQKAYRIKELVGDVVGVLDSYGAEQAFVVGHDWGAPVAWTFAWLHPDRCAGVVGISVPFAGRGVIGLPGSPFGERRPSDYHLELAGPGRVWYQDYFAVQDGIITEIEEDLRGWLLGLTYTVSGEGMMAATKAAVDAGVDLESMDPIDVIRAGPLCMAEGARLKDAFVYPETMPAWFTEADLDFYTGEFERSGFGGPLSFYHNIDNDWHDLADQQGKPLTPPALFIGGQYDVGTIWGAQAIERAHEVMPNYRGTHMIADVGHWIQQEAPEETNRLLLDFLGGLRP
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for ephB? Email the maintainer — the message is pre-filled with this gene's details.