mazE5 Resolved · medium auto-curated

H37Rv Rv1943c · MTBC0 mtbc0_002057 · 125 aa · 2214086–2214463 (-) · RefSeq NP_216459.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin MazE5
MTBC0 PGAP re-annotationtype II toxin-antitoxin system antitoxin MazE5
Revised (this work)Type II toxin-antitoxin system antitoxin MazE5.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJ89 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin MazE5
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin MazF5.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionEvidence 4 Homologs of previously reported genes of
Orthologous group2FDS3
Gene Ontology (6) GO:0008150, GO:0040008, GO:0045927, GO:0048518, GO:0050789, GO:0065007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.653 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mazF5 (toxin MazF5), high confidence from genomic context alone (score 883 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1942c mazF5 toxin MazF5 957 883 ctx neighborhood:882 textmining:654
Rv1944c hyp hypothetical protein 807 806 ctx neighborhood:801
Rv1945 hyp hypothetical protein 583 583 ctx neighborhood:581
Rv1102c mazF3 mRNA interferase MazF3 449 72 textmining:431
Rv1991c mazF6 mRNA interferase MazF6 522 65 textmining:510
Rv2801c mazF9 mRNA interferase MazF9 523 62 textmining:513
Rv1494 mazE4 antitoxin MazE4 635 55 textmining:630
Rv2545 vapB18 antitoxin VapB18 803 44 textmining:803
Rv1114 vapC32 ribonuclease VapC32 652 44 textmining:651
Rv0301 vapC2 ribonuclease VapC2 631 44 textmining:630
Rv2063 mazE7 antitoxin MazE7 760 43 textmining:760
Rv2493 vapB38 antitoxin VapB38 653 41 textmining:653
Rv3321c vapB44 antitoxin VapB44 651 41 textmining:651
Rv2547 vapB19 antitoxin VapB19 547 41 textmining:547
Rv2494 vapC38 ribonuclease VapC38 510 41 textmining:510

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin MazE5
  • MTBC0 PGAP product: type II toxin-antitoxin system antitoxin MazE5
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216459.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2FDS3
  • Curated reference: UniProt P9WJ89 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor mazF5
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002057|Rv1943c|mazE5
MKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDEALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS