mazE5 Resolved · medium auto-curated
H37Rv Rv1943c · MTBC0 mtbc0_002057 ·
125 aa · 2214086–2214463 (-) ·
RefSeq NP_216459.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | antitoxin MazE5 |
|---|---|
| MTBC0 PGAP re-annotation | type II toxin-antitoxin system antitoxin MazE5 |
| Revised (this work) | Type II toxin-antitoxin system antitoxin MazE5. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WJ89
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Antitoxin MazE5 |
| Curated function | Antitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin MazF5. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Evidence 4 Homologs of previously reported genes of |
| Orthologous group | 2FDS3 |
| Gene Ontology (6) |
GO:0008150, GO:0040008, GO:0045927, GO:0048518, GO:0050789, GO:0065007
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.653 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mazF5 (toxin MazF5), high confidence from genomic context alone (score 883 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1942c mazF5 |
toxin MazF5 | 957 | 883 ctx | neighborhood:882 textmining:654 |
Rv1944c hyp |
hypothetical protein | 807 | 806 ctx | neighborhood:801 |
Rv1945 hyp |
hypothetical protein | 583 | 583 ctx | neighborhood:581 |
Rv1102c mazF3 |
mRNA interferase MazF3 | 449 | 72 | textmining:431 |
Rv1991c mazF6 |
mRNA interferase MazF6 | 522 | 65 | textmining:510 |
Rv2801c mazF9 |
mRNA interferase MazF9 | 523 | 62 | textmining:513 |
Rv1494 mazE4 |
antitoxin MazE4 | 635 | 55 | textmining:630 |
Rv2545 vapB18 |
antitoxin VapB18 | 803 | 44 | textmining:803 |
Rv1114 vapC32 |
ribonuclease VapC32 | 652 | 44 | textmining:651 |
Rv0301 vapC2 |
ribonuclease VapC2 | 631 | 44 | textmining:630 |
Rv2063 mazE7 |
antitoxin MazE7 | 760 | 43 | textmining:760 |
Rv2493 vapB38 |
antitoxin VapB38 | 653 | 41 | textmining:653 |
Rv3321c vapB44 |
antitoxin VapB44 | 651 | 41 | textmining:651 |
Rv2547 vapB19 |
antitoxin VapB19 | 547 | 41 | textmining:547 |
Rv2494 vapC38 |
ribonuclease VapC38 | 510 | 41 | textmining:510 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: antitoxin MazE5
- MTBC0 PGAP product: type II toxin-antitoxin system antitoxin MazE5
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216459.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2FDS3 - Curated reference: UniProt P9WJ89 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
15 functional partner(s); context anchor
mazF5 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002057|Rv1943c|mazE5 MKTARLQVTLRCAVDLINSSSDQCFARIEHVASDQADPRPGVWHSSGMNRIRLSTTVDAALLTSARDMRAGITDAALIDEALAALLARHRSAEVDASYAAYDKHPVDEPDEWGDLASWRRAAGDS