parE1 Family assigned · medium auto-curated

H37Rv Rv1959c · MTBC0 mtbc0_002074 · 98 aa · 2222797–2223093 MTBC0 (-) · RefSeq NP_216475.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand ephB (Rv1938) — requalified: epoxide hydrolase EphB Rv1939 (Rv1939) — family_assigned: flavin reductase family protein Rv1941 (Rv1941) — family_assigned: SDR family oxidoreductase mazF5 (Rv1942c) — family_assigned: type II toxin-antitoxin system PemK/MazF family toxin mazE5 (Rv1943c) — requalified: type II toxin-antitoxin system antitoxin MazE5 Rv1944c (Rv1944c) — family_assigned: SEC-C domain-containing protein Rv1945 (Rv1945) — requalified: HNH endonuclease signature motif containing protein Rv1945 lppG (Rv1946c) — family_assigned: lipoprotein Rv1947 (Rv1947) — family_assigned: hypothetical protein Rv1948c (Rv1948c) — family_assigned: hypothetical protein Rv1950c (Rv1950c) — dark: hypothetical protein Rv1951c (Rv1951c) — dark: hypothetical protein vapB14 (Rv1952) — requalified: antitoxin Rv1954c (Rv1954c) — requalified: hypothetical protein higB (Rv1955) — requalified: type II toxin-antitoxin system toxin HigB higA (Rv1956) — requalified: type II toxin-antitoxin system antitoxin HigA Rv1957 (Rv1957) — requalified: SecB-like chaperone Rv1958c (Rv1958c) — dark: hypothetical protein parE1 (Rv1959c) — family_assigned: type II toxin-antitoxin system RelE/ParE family toxin parD1 (Rv1960c) — family_assigned: type II toxin-antitoxin system ParD family antitoxin Rv1961 (Rv1961) — family_assigned: hypothetical protein vapC35 (Rv1962c) — family_assigned: type II toxin-antitoxin system VapC family toxin mce3R (Rv1963c) — family_assigned: TetR family transcriptional regulator Mce3R mce3R yrbE3A (Rv1964) — family_assigned: ABC transporter permease yrbE3B (Rv1965) — family_assigned: ABC transporter permease mce3B (Rv1967) — family_assigned: virulence factor Mce family protein mce3B mce3C (Rv1968) — family_assigned: virulence factor Mce family protein mce3C mce3D (Rv1969) — family_assigned: virulence factor Mce family protein mce3D lprM (Rv1970) — family_assigned: Mce family lipoprotein LprM lprM mce3F (Rv1971) — family_assigned: MlaD family protein 2 212 kb 2 216 kb 2 220 kb 2 224 kb 2 228 kb 2 232 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)toxin ParE1
MTBC0 PGAP re-annotationtype II toxin-antitoxin system RelE/ParE family toxin
Revised (this work)Type II toxin-antitoxin system RelE/ParE family toxin. Pfam: ParE_toxin (PF05016.22).
Functional category (TubercuList)virulence, detoxification, adaptation

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 2 publications

2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).

PublicationDate
Association between toxin-antitoxin system mutations and global transmission of MDR-TB. doi:10.1186/s12879-024-10142-4 2024
Toxin-antitoxin system gene mutations driving Mycobacterium tuberculosis transmission revealed by whole genome sequencing. doi:10.3389/fmicb.2024.1398886 2024

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene

NeighbourparD1 (Rv1960c, - strand)
Overlap4 bp, 1 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 0.58 (95% CI -0.28 to 1.88). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1994c · 99.0% identity
M. orygis RJtmp_002033 · 99.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WHG7 SwissProt · reviewed · Evidence at protein level
UniProt nameToxin ParE1
Curated functionToxic component of a type II toxin-antitoxin (TA) system. Upon expression in E.coli inhibits cell growth and colony formation. Its toxic effect is neutralized by coexpression with cognate antitoxin ParD1.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameparE1
eggNOG descriptionBelongs to the RelE toxin family
Orthologous groupCOG3668
KEGG orthology K19092
Gene Ontology (6) GO:0008150, GO:0040008, GO:0045926, GO:0048519, GO:0050789, GO:0065007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.648 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.18% of strains (265) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacterium

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 9/53 (17%) · mean identity 63.3% · 1/4 closest MTBAP relatives
present in a subset of the genus (9/53 NTM; in 1 of the 4 closest MTBAP relatives) — partial/intermediate conservation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

short ORF (98 aa) a shallow stratum may reflect homology-detection failure, not true youth
present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 7 in the ORF — 0 in the essential state, 0 growth-defect, 2 non-essential, 5 growth-advantage. Saturation 1.000, mean read count 151.428571429. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 7 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 7 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 8 of 16 independent MS datasets
Integrated abundance21.1 ppm · rank 2311/3519 (34.4th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length98 aa
Molecular weight11.3 kDa
Theoretical pI6.4
GRAVY-0.561 (hydrophilic)
Aliphatic index83.7
Aromaticity0.082
Instability index44.6 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ParE_toxinPF05016.22 4.9e-245–93 ParE toxin of type II toxin-antitoxin system, parDE

Experimental structures (Protein Data Bank) 1 solved

PDBMethodResolutionCoverage
8c24 X-ray diffraction 2.1 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.5

PDB hitprobTM-scoreE-valueDescription
8c24-assembly1_B 1.00 0.93 2.7e-16 sig 8c24-assembly1_B ParDE1 toxin-antitoxin complex from Mycobacterium tuberculosis (rv1960c-rv1959c)
3kxe-assembly1_B 1.00 0.94 3.1e-10 sig 3kxe-assembly1_B A conserved mode of protein recognition and binding in a ParD-ParE toxin-antitoxin complex
7r5a-assembly1_A-2 1.00 0.91 1.2e-09 sig 7r5a-assembly1_A-2 Vibrio cholera ParD2:ParE2 antitoxin:toxin complex
7ycu-assembly1_C-2 1.00 0.95 2.1e-08 sig 7ycu-assembly1_C-2 Heterotetramer of Antitoxin PrpA together with Toxin PrpT from Pseudoalteromonas rubra
5ceg-assembly1_B 1.00 0.82 2.4e-07 sig 5ceg-assembly1_B X-ray structure of toxin/anti-toxin complex from Mesorhizobium opportunistum

Foldseek search of the AlphaFold DB model (mean pLDDT 92.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)Rv1958c (- strand, 48 bp gap)
Downstream (3' on genome)parD1 (- strand, -4 bp gap)
Predicted operon Rv1958c · parE1 · parD1

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) kstR (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: parD1 (antitoxin ParD1), high confidence from genomic context alone (score 995 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1960c parD1 exp antitoxin ParD1 999 995 ctx neighborhood:882 cooccurence:774 experimental:756 textmining:815
Rv2472 hyp exp hypothetical protein 775 766 experimental:756
Rv2801A mazE9 exp antitoxin MazE9 774 764 experimental:756
Rv1103c mazE3 exp antitoxin MazE3 774 764 experimental:756
Rv1958c hyp hypothetical protein 655 656 ctx neighborhood:647
Rv1961 hyp hypothetical protein 589 589 ctx neighborhood:585
Rv2515c hyp hypothetical protein 416 417
Rv2142c parE2 toxin ParE2 876 87 textmining:870
Rv1603 hisA 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 517 55 textmining:510
Rv2142A parD2 antitoxin ParD2 841 41 textmining:841

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: toxin ParE1
  • MTBC0 PGAP product: type II toxin-antitoxin system RelE/ParE family toxin
  • Pfam (hmmscan --cut_ga): ParE_toxin PF05016.22 (E=5e-24)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216475.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ParE_toxin (PF05016.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3668
  • Curated reference: UniProt P9WHG7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.5)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor parD1
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002074|Rv1959c|parE1
MSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEGTIDVVRVLHQRMDVDRNL