Rv0188 Resolved · high auto-curated

H37Rv Rv0188 · MTBC0 mtbc0_000202 · 143 aa · 219834–220265 (+) · RefSeq NP_214702.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationSPW repeat protein
Revised (this work)SPW repeat protein. Pfam: SPW (PF03779.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07432 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionSPW repeat
Orthologous group2DUIA

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.354 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SPWPF03779.21 4.6e-1935–129 SPW repeat domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0048c (membrane protein), high confidence from genomic context alone (score 747 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0048c membrane protein 746 747 ctx cooccurence:746
Rv1171 hyp hypothetical protein 693 694 ctx cooccurence:691
Rv1635c mannosyltransferase 600 600 ctx cooccurence:596
Rv0187 O-methyltransferase 543 544 ctx neighborhood:541
Rv1885c chorismate mutase 538 538 ctx cooccurence:538
Rv3773c hyp hypothetical protein 531 532 ctx cooccurence:525
Rv3202c adnA ATP-dependent DNA helicase 518 518 ctx cooccurence:518
Rv0648 alpha-mannosidase 505 506 ctx cooccurence:499
Rv0875c hyp hypothetical protein 490 490 ctx cooccurence:487
Rv3830c TetR family transcriptional regulator 486 487 ctx cooccurence:472
Rv2079 hyp hypothetical protein 483 484 ctx cooccurence:477
Rv2423 hyp hypothetical protein 468 468 ctx cooccurence:466
Rv1226c transmembrane protein 461 462 ctx cooccurence:459
Rv1776c transcriptional regulator 440 440 ctx cooccurence:423
Rv3779 transmembrane protein 434 434 ctx cooccurence:434

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: SPW repeat protein
  • Pfam (hmmscan --cut_ga): SPW PF03779.21 (E=5e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214702.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SPW (PF03779.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DUIA
  • Curated reference: UniProt O07432 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 35 functional partner(s); context anchor Rv0048c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000202|Rv0188|
MSTVHSSIDQHPDLLALRASFDRAAESTIAHFTFGLALLAGLYVAASPWIVGFSATRGLPTCDLIVGIAVAYLAYGFASALDRTHGMTWTLPVLGVWVIFSPWVLPGVAVTAGMMWSHIIAGAVVAVLGFYFGMRTRAAANQG