Rv1944c Family assigned · medium auto-curated

H37Rv Rv1944c · MTBC0 mtbc0_002058 · 196 aa · 2214460–2215050 (-) · RefSeq NP_216460.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationSEC-C domain-containing protein
Revised (this work)SEC-C domain-containing protein. Pfam: SEC-C (PF02810.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95270 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionSEC-C motif
Orthologous groupCOG3012

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.636 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.23% of strains (333) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SEC-CPF02810.22 3.3e-09168–185 SEC-C motif

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mazE5 (antitoxin MazE5), high confidence from genomic context alone (score 806 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1943c mazE5 antitoxin MazE5 807 806 ctx neighborhood:801
Rv1942c mazF5 toxin MazF5 802 802 ctx neighborhood:801
Rv0732 secY preprotein translocase SecY 816 796 experimental:788
Rv1440 secG protein-export membrane protein SecG 812 792 experimental:785
Rv0638 secE1 preprotein translocase SecE 797 775 experimental:775
Rv1629 polA DNA polymerase I 751 659 coexpression:639
Rv1945 hyp hypothetical protein 608 591 ctx neighborhood:588
Rv1015c rplY 50S ribosomal protein L25/general stress protein Ctc 672 566 experimental:431
Rv0708 rplP 50S ribosomal protein L16 518 517 experimental:431
Rv0640 rplK 50S ribosomal protein L11 509 508 experimental:434
Rv0703 rplW 50S ribosomal protein L23 524 506 experimental:498
Rv0709 rpmC 50S ribosomal protein L29 509 490 experimental:484
Rv0979A rpmF 50S ribosomal protein L32 486 487 experimental:431
Rv0651 rplJ 50S ribosomal protein L10 489 470 experimental:431
Rv3443c rplM 50S ribosomal protein L13 491 468 experimental:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: SEC-C domain-containing protein
  • Pfam (hmmscan --cut_ga): SEC-C PF02810.22 (E=3e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216460.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SEC-C (PF02810.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3012
  • Curated reference: UniProt P95270 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 54 functional partner(s); context anchor mazE5
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002058|Rv1944c|
MISDTEDFAHGDKAAPPRLRASYAACGGDAAGCWTMSDNGASRVPPVDETPAAESAEPITAVSLAWLPAGDYERALDLWPDFAGSDLVTGPDGPVAHPLYCRRMQQKLVEFAEAGFPGLAVAAIRVAPFAAWCAEQGQEPDSPEARAEYAAYLTAHGDHDVMAWPPGRNQQCWCGSGHKYKKCCAAASFIDTEPAP