Rv1374c Still unknown · low auto-curated

H37Rv Rv1374c · MTBC0 mtbc0_001475 · 152 aa · 1556416–1556874 (-) · RefSeq NP_215890.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 7x75-assembly1_D Cryo-EM structure of Streptomyces coelicolor RNAP-pro (prob 0.04, TM 0.33).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P71802 TrEMBL · unreviewed · Predicted
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.076 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.10% of strains (148) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 55.4 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7x75-assembly1_D 0.04 0.33 8.3e+00 7x75-assembly1_D Cryo-EM structure of Streptomyces coelicolor RNAP-promoter open complex with three Zur dimers

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv1375 hyp hypothetical protein 405 405 ctx neighborhood:401
Rv1376 hyp hypothetical protein 490 403 ctx neighborhood:401
Rv0046c ino1 inositol-3-phosphate synthase 550 55 textmining:544
Rv1954c hyp hypothetical protein 521 55 textmining:514
Rv1805c hyp hypothetical protein 576 54 textmining:571
Rv2081c transmembrane protein 631 52 textmining:627
Rv2660c hyp hypothetical protein 562 50 textmining:558
Rv1734c hyp hypothetical protein 658 47 textmining:656
Rv0061c hyp hypothetical protein 651 41 textmining:651
Rv1954A Rv1954A, len: 100 aa. Hypothetical unknown protein. 513 41 textmining:513
Rv1806 PE20 PE family protein PE20 433 41 textmining:433

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 7x75-assembly1_D Cryo-EM structure of Streptomyces coelicolor RNAP-promoter open (prob 0.04, E=8e+00, TM=0.33)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215890.2)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt P71802 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 55.4, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001475|Rv1374c|
MVTSVADENVASRIASWGTGPAPDPRLDYAHAHLKGRRGRSPARPNAPIGARSFAVGRKICRVERFTLLEHGFVGHALHRVPCAGLVALVMSACSLAVCREVGNYAQRRVGRFAFFEQTFVRHALTPRCSRTDSKASYTQLNRICKFPPHWV