yrbE3B Family assigned · medium auto-curated
H37Rv Rv1965 · MTBC0 mtbc0_002081 ·
271 aa ·
2227624–2228439 MTBC0
(+) ·
RefSeq NP_216481.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | integral membrane protein |
|---|---|
| MTBC0 PGAP re-annotation | ABC transporter permease |
| Revised (this work) | ABC transporter permease. Pfam: MlaE (PF02405.22). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 1 publication
1 TB publication mentions this gene. 1 publication(s) discuss this gene (1 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Evaluation of immunodominant peptides of in vivo expressed mycobacterial antigens in an ELISA-based diagnostic assay for pulmonary tuberculosis. doi:10.1007/s42770-023-00998-0 | 2023 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Mce3R (mce3R).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 1.00 (95% CI -0.77 to 3.90). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. marinum |
MMAR_2881
· 91.4% identity |
|---|---|
| M. smegmatis |
MSMEG_0345
· 69.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53966
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Conserved hypothetical integral membrane protein YrbE3B |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| Preferred name | yrbE3B |
| eggNOG description | ABC-type transport system involved in resistance to organic solvents, permease component |
| Orthologous group | COG0767 |
| KEGG orthology |
K02066
|
| KEGG pathways |
map02010
|
| KEGG modules |
M00210, M00669, M00670
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.096 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 5 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.46% of strains (664) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 71.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 6/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 51.5% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Regions of Difference (lineage deletions)
| RD | Gene overlap | Deleted in lineages |
|---|---|---|
RD7 |
100% | L6, L9, Microti, Orygis, Bovis, La4, Caprae |
This locus overlaps a Region of Difference — a large deletion that is absent in the listed lineages (from the consolidated MTBC RD analysis over ~145 000 strains; H37Rv coordinates). The gene-overlap column is the fraction of the gene inside the RD. RD deletions are classic lineage markers (e.g. RD9 absent in the animal / M. africanum lineages); a gene deleted in a whole lineage is dispensable there.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 16 in the ORF — 0 in the essential state, 0 growth-defect, 16 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 159.125. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) not detected
Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (5 TM helixes) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 5 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 271 aa |
|---|---|
| Molecular weight | 28.1 kDa |
| Theoretical pI | 6.9 |
| GRAVY | 0.824 (hydrophobic) |
| Aliphatic index | 111.2 |
| Aromaticity | 0.089 |
| Instability index | 20.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MlaE | PF02405.22 | 5.3e-53 | 53–258 | Permease MlaE |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 88.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8fef-assembly1_J |
1.00 | 0.97 | 1.9e-19 sig | 8fef-assembly1_J Structure of Mce1 transporter from Mycobacterium smegmatis (Map0) |
7ch9-assembly1_G |
1.00 | 0.85 | 3.1e-09 sig | 7ch9-assembly1_G Cryo-EM structure of P.aeruginosa MlaFEBD |
7d06-assembly1_A |
1.00 | 0.91 | 9.3e-09 sig | 7d06-assembly1_A Cryo EM structure of the nucleotide free Acinetobacter MlaFEDB complex |
8fee-assembly1_I |
1.00 | 0.83 | 5.5e-09 sig | 8fee-assembly1_I Structure of Mce1 transporter from Mycobacterium smegmatis in the absence of LucB (Map2) |
7ch9-assembly1_H |
1.00 | 0.86 | 5.1e-08 sig | 7ch9-assembly1_H Cryo-EM structure of P.aeruginosa MlaFEBD |
Foldseek search of the AlphaFold DB model (mean pLDDT 88.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 12
| Upstream (5' on genome) | yrbE3A (+ strand, 9 bp gap) |
|---|---|
| Downstream (3' on genome) | mce3A (+ strand, 4 bp gap) |
| Predicted operon |
yrbE3A · yrbE3B · mce3A · mce3B · mce3C · mce3D · lprM · mce3F · Rv1972 · Rv1973 · Rv1974 · Rv1975
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (6 TF) |
Rv0047c (activates) · Rv0081 (activates) · Rv0324 (activates) · mmpR5 (activates) · Rv1353c (activates) · higA (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: lprM (Mce family lipoprotein LprM), high confidence from genomic context alone (score 996 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1970 lprM |
Mce family lipoprotein LprM | 997 | 996 ctx | neighborhood:785 cooccurence:771 coexpression:881 textmining:409 |
Rv1967 mce3B |
Mce family protein Mce3B | 996 | 996 ctx | neighborhood:785 cooccurence:773 coexpression:881 |
Rv1968 mce3C |
Mce family protein Mce3C | 995 | 996 ctx | neighborhood:799 cooccurence:773 coexpression:872 |
Rv1966 mce3A |
Mce family protein Mce3A | 998 | 995 ctx | neighborhood:785 cooccurence:757 coexpression:881 textmining:659 |
Rv1971 mce3F |
Mce family protein Mce3F | 995 | 995 ctx | neighborhood:799 cooccurence:771 coexpression:849 |
Rv1969 mce3D |
Mce family protein Mce3D | 997 | 994 ctx | neighborhood:785 cooccurence:768 coexpression:844 textmining:661 |
Rv0655 mkl exp |
ABC transporter ATP-binding protein | 989 | 987 ctx | cooccurence:773 coexpression:450 experimental:505 database:800 |
Rv1964 yrbE3A |
integral membrane protein | 987 | 985 ctx | neighborhood:789 coexpression:860 |
Rv1972 |
Mce associated membrane protein | 988 | 976 ctx | neighborhood:715 cooccurence:620 coexpression:793 textmining:548 |
Rv0170 mce1B |
Mce family protein Mce1B | 887 | 883 ctx | cooccurence:772 |
Rv3497c mce4C |
Mce family protein Mce4C | 882 | 875 ctx | cooccurence:772 |
Rv0590 mce2B |
Mce-family protein Mce2B; Rv0590, (MTCY19H5.32c), len: 275 aa. Mce2B; belongs to 24-membered Mycobacterium tuberculosis Mce protein family ( | 879 | 875 ctx | cooccurence:773 |
Rv0174 mce1F |
Mce family protein Mce1F | 880 | 874 ctx | cooccurence:754 |
Rv0171 mce1C |
Mce family protein Mce1C | 879 | 873 ctx | cooccurence:752 |
Rv0173 lprK |
Mce family lipoprotein LprK | 879 | 872 ctx | cooccurence:767 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: integral membrane protein
- MTBC0 PGAP product: ABC transporter permease
- Pfam (hmmscan --cut_ga): MlaE PF02405.22 (E=5e-53)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216481.1)
- Domains: Pfam-A via hmmscan --cut_ga — MlaE (PF02405.22)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0767 - Curated reference: UniProt O53966 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 88.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
52 functional partner(s); context anchor
lprM - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Regions of Difference: consolidated MTBC RD analysis (H37Rv coordinates); RD framework from Brosch et al. 2002 (doi:10.1073/pnas.052548299) and Gagneux & Small 2007 (doi:10.1016/S1473-3099(07)70108-1)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002081|Rv1965|yrbE3B MTAAKALVSEWNRMGSQMRFFVGTLAGIPDALMHYRGELLRVIAQMGLGTGVLAVIGGTVAIVGFLAMTTGAIVAVQGYNQFASVGVEALTGFASAFFNTREIQPGTVMVALAATVGAGTTAALGAMRINEEIDALEVIGIRSISYLASTRVLAGVVVAVPLFCVGLMTAYLAARVGTTAIYGQGSGVYDHYFNTFLRPTDVLWSSVEVVVVALMIMLVCTYYGYAAHGGPAGVGEAVGRAVRASMVVASIAILVMTLAIYGQSPNFHLAT
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for yrbE3B? Email the maintainer — the message is pre-filled with this gene's details.