yrbE3B Family assigned · medium auto-curated

H37Rv Rv1965 · MTBC0 mtbc0_002081 · 271 aa · 2227624–2228439 (+) · RefSeq NP_216481.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotationABC transporter permease
Revised (this work)ABC transporter permease. Pfam: MlaE (PF02405.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53966 TrEMBL · unreviewed · Predicted
UniProt nameConserved hypothetical integral membrane protein YrbE3B

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
Preferred nameyrbE3B
eggNOG descriptionABC-type transport system involved in resistance to organic solvents, permease component
Orthologous groupCOG0767
KEGG orthology K02066
KEGG pathways map02010
KEGG modules M00210, M00669, M00670

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.096 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.46% of strains (664) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MlaEPF02405.22 5.3e-5353–258 Permease MlaE

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lprM (Mce family lipoprotein LprM), high confidence from genomic context alone (score 996 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1970 lprM Mce family lipoprotein LprM 997 996 ctx neighborhood:785 cooccurence:771 coexpression:881 textmining:409
Rv1967 mce3B Mce family protein Mce3B 996 996 ctx neighborhood:785 cooccurence:773 coexpression:881
Rv1968 mce3C Mce family protein Mce3C 995 996 ctx neighborhood:799 cooccurence:773 coexpression:872
Rv1966 mce3A Mce family protein Mce3A 998 995 ctx neighborhood:785 cooccurence:757 coexpression:881 textmining:659
Rv1971 mce3F Mce family protein Mce3F 995 995 ctx neighborhood:799 cooccurence:771 coexpression:849
Rv1969 mce3D Mce family protein Mce3D 997 994 ctx neighborhood:785 cooccurence:768 coexpression:844 textmining:661
Rv0655 mkl ABC transporter ATP-binding protein 989 987 ctx cooccurence:773 coexpression:450 experimental:505 database:800
Rv1964 yrbE3A integral membrane protein 987 985 ctx neighborhood:789 coexpression:860
Rv1972 Mce associated membrane protein 988 976 ctx neighborhood:715 cooccurence:620 coexpression:793 textmining:548
Rv0170 mce1B Mce family protein Mce1B 887 883 ctx cooccurence:772
Rv3497c mce4C Mce family protein Mce4C 882 875 ctx cooccurence:772
Rv0590 mce2B Mce-family protein Mce2B; Rv0590, (MTCY19H5.32c), len: 275 aa. Mce2B; belongs to 24-membered Mycobacterium tuberculosis Mce protein family ( 879 875 ctx cooccurence:773
Rv0174 mce1F Mce family protein Mce1F 880 874 ctx cooccurence:754
Rv0171 mce1C Mce family protein Mce1C 879 873 ctx cooccurence:752
Rv0173 lprK Mce family lipoprotein LprK 879 872 ctx cooccurence:767

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: integral membrane protein
  • MTBC0 PGAP product: ABC transporter permease
  • Pfam (hmmscan --cut_ga): MlaE PF02405.22 (E=5e-53)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216481.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MlaE (PF02405.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0767
  • Curated reference: UniProt O53966 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 52 functional partner(s); context anchor lprM
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002081|Rv1965|yrbE3B
MTAAKALVSEWNRMGSQMRFFVGTLAGIPDALMHYRGELLRVIAQMGLGTGVLAVIGGTVAIVGFLAMTTGAIVAVQGYNQFASVGVEALTGFASAFFNTREIQPGTVMVALAATVGAGTTAALGAMRINEEIDALEVIGIRSISYLASTRVLAGVVVAVPLFCVGLMTAYLAARVGTTAIYGQGSGVYDHYFNTFLRPTDVLWSSVEVVVVALMIMLVCTYYGYAAHGGPAGVGEAVGRAVRASMVVASIAILVMTLAIYGQSPNFHLAT