higB Resolved · high auto-curated

H37Rv Rv1955 · MTBC0 mtbc0_002070 · 125 aa · 2220835–2221212 (+) · RefSeq NP_216471.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)toxin HigB
MTBC0 PGAP re-annotationtype II toxin-antitoxin system toxin HigB
Revised (this work)Type II toxin-antitoxin system toxin HigB. Pfam: Gp49 (PF05973.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJA5 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable endoribonuclease HigB1
EC (curated) EC 3.1.-.-
Curated functionToxic component of an atypical, type II toxin-antitoxin chaperone (TAC) system. Upon expression in M.smegmatis inhibits colony formation and cell growth. Ectopic expression in wild-type M.tuberculosis has no effect on cell growth; ectopic expression in a triple higB1-higA1-Rv1957 (delta TAC) disruption mutant causes growth arrest, killing a considerable proportion of the cells. Increased ectopic expression leads to decreased levels of IdeR- and Zur-regulated genes as well as cleavage within the mRNA region of tmRNA (transfer-mRNA), strongly suggesting it is an endoribonuclease; also degrades E.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPhage derived protein Gp49-like (DUF891)
Orthologous groupCOG4679
Gene Ontology (40) GO:0001666, GO:0003674, GO:0003824, GO:0004518, GO:0004519, GO:0004521, GO:0004540, GO:0006139, GO:0006725, GO:0006807, GO:0006950, GO:0008150 +28 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Gp49PF05973.21 1.5e-1827–113 Phage derived protein Gp49-like (DUF891)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: higA (antitoxin HigA), high confidence from genomic context alone (score 952 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1956 higA antitoxin HigA 993 952 ctx neighborhood:682 coexpression:731 experimental:484 textmining:880
Rv1957 secBL SecB-like chaperone 970 783 ctx neighborhood:695 textmining:870
Rv1954A Rv1954A, len: 100 aa. Hypothetical unknown protein. 618 513 ctx neighborhood:513
Rv1077 cbs cystathionine beta-synthase 547 511 experimental:484
Rv1843c guaB1 inosine-5'-monophosphate dehydrogenase 542 505 experimental:484
Rv2021c higA2 transcriptional regulator 684 78 textmining:672
Rv3183 higA3 transcriptional regulator 471 78 textmining:451
Rv1952 vapB14 antitoxin VapB14 591 76 textmining:576
Rv1954c hyp hypothetical protein 527 70 textmining:513
Rv3384c vapC46 ribonuclease VapC46 447 64 textmining:434
Rv1246c relE toxin RelE 838 56 textmining:836
Rv1102c mazF3 mRNA interferase MazF3 439 56 textmining:431
Rv2829c vapC22 ribonuclease VapC22 444 55 textmining:436
Rv2022c higB2 hyp hypothetical protein 809 52 textmining:807
Rv1991c mazF6 mRNA interferase MazF6 518 52 textmining:513

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: toxin HigB
  • MTBC0 PGAP product: type II toxin-antitoxin system toxin HigB
  • Pfam (hmmscan --cut_ga): Gp49 PF05973.21 (E=1e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216471.2)
  • Domains: Pfam-A via hmmscan --cut_ga — Gp49 (PF05973.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4679
  • Curated reference: UniProt P9WJA5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor higA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002070|Rv1955|higB
MPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLFFRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI