higB Resolved · high auto-curated

H37Rv Rv1955 · MTBC0 mtbc0_002070 · 125 aa · 2220835–2221212 MTBC0 (+) · RefSeq NP_216471.2

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv1937 (Rv1937) — requalified: FAD-binding oxidoreductase Rv1937 ephB (Rv1938) — requalified: epoxide hydrolase EphB ephB Rv1939 (Rv1939) — family_assigned: flavin reductase family protein Rv1941 (Rv1941) — family_assigned: SDR family oxidoreductase mazF5 (Rv1942c) — family_assigned: type II toxin-antitoxin system PemK/MazF family toxin mazE5 (Rv1943c) — requalified: type II toxin-antitoxin system antitoxin MazE5 Rv1944c (Rv1944c) — family_assigned: SEC-C domain-containing protein Rv1945 (Rv1945) — requalified: HNH endonuclease signature motif containing protein Rv1945 lppG (Rv1946c) — family_assigned: lipoprotein Rv1947 (Rv1947) — family_assigned: hypothetical protein Rv1948c (Rv1948c) — family_assigned: hypothetical protein Rv1950c (Rv1950c) — dark: hypothetical protein Rv1951c (Rv1951c) — dark: hypothetical protein vapB14 (Rv1952) — requalified: antitoxin Rv1954c (Rv1954c) — requalified: hypothetical protein higB (Rv1955) — requalified: type II toxin-antitoxin system toxin HigB higA (Rv1956) — requalified: type II toxin-antitoxin system antitoxin HigA Rv1957 (Rv1957) — requalified: SecB-like chaperone Rv1958c (Rv1958c) — dark: hypothetical protein parE1 (Rv1959c) — family_assigned: type II toxin-antitoxin system RelE/ParE family toxin parD1 (Rv1960c) — family_assigned: type II toxin-antitoxin system ParD family antitoxin Rv1961 (Rv1961) — family_assigned: hypothetical protein vapC35 (Rv1962c) — family_assigned: type II toxin-antitoxin system VapC family toxin mce3R (Rv1963c) — family_assigned: TetR family transcriptional regulator Mce3R mce3R yrbE3A (Rv1964) — family_assigned: ABC transporter permease yrbE3B (Rv1965) — family_assigned: ABC transporter permease mce3B (Rv1967) — family_assigned: virulence factor Mce family protein mce3B mce3C (Rv1968) — family_assigned: virulence factor Mce family protein mce3C mce3D (Rv1969) — family_assigned: virulence factor Mce family protein mce3D 2 212 kb 2 216 kb 2 220 kb 2 224 kb 2 228 kb 2 232 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)toxin HigB
MTBC0 PGAP re-annotationtype II toxin-antitoxin system toxin HigB
Revised (this work)Type II toxin-antitoxin system toxin HigB. Pfam: Gp49 (PF05973.21).
Functional category (TubercuList)virulence, detoxification, adaptation

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 9 publications

9 TB publications mention this gene. 9 publication(s) discuss this gene (10 in a M. tuberculosis context, 2 in other mycobacteria — M. marinum (1), M. smegmatis (1)).

Most recent 5 of 9.
PublicationDate
A multi-omics investigation into the mechanisms of hyper-virulence in Mycobacterium tuberculosis. doi:10.1080/21505594.2022.2087304 2022
HigB1 Toxin in Mycobacterium tuberculosis Is Upregulated During Stress and Required to Establish Infection in Guinea Pigs. doi:10.3389/fmicb.2021.748890 2021
Induced DNA bending by unique dimerization of HigA antitoxin. doi:10.1107/S2052252520006466 2020
Directed evolution of SecB chaperones toward toxin-antitoxin systems. doi:10.1073/pnas.1710456114 2017
[Polymorphisms of toxin-antitoxin-chaperone system of Mycobacterium tuberculosis complex in China]. doi:10.3760/cma.j.issn.0254-6450.2016.03.021 2016

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) antiparallel · 7 % of gene

NeighbourRv1954c (Rv1954c, - strand)
Overlap26 bp, 7 % of this gene's length

antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 1.69 (95% CI -0.18 to 5.02). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1990 · 100.0% identity
M. orygis RJtmp_002029 · 99.2% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WJA5 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable endoribonuclease HigB1
EC (curated) EC 3.1.-.-
Curated functionToxic component of an atypical, type II toxin-antitoxin chaperone (TAC) system. Upon expression in M.smegmatis inhibits colony formation and cell growth. Ectopic expression in wild-type M.tuberculosis has no effect on cell growth; ectopic expression in a triple higB1-higA1-Rv1957 (delta TAC) disruption mutant causes growth arrest, killing a considerable proportion of the cells. Increased ectopic expression leads to decreased levels of IdeR- and Zur-regulated genes as well as cleavage within the mRNA region of tmRNA (transfer-mRNA), strongly suggesting it is an endoribonuclease; also degrades E.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPhage derived protein Gp49-like (DUF891)
Orthologous groupCOG4679
Gene Ontology (40) GO:0001666, GO:0003674, GO:0003824, GO:0004518, GO:0004519, GO:0004521, GO:0004540, GO:0006139, GO:0006725, GO:0006807, GO:0006950, GO:0008150 +28 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) MTBC-specific

M. canettii dN/dS (deep-divergence selection) inf (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 0/53 (0%) · 0/4 closest MTBAP relatives
absent from ALL 53 non-MTBC Mycobacterium genomes tested (incl. the closest MTBAP relatives) — a candidate MTBC-specific genetic innovation / host-adaptation factor (confirm by synteny; rule out a short/low-complexity ORF and extreme divergence)
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

absent from the whole genus and from all outgroups tested — a candidate MTBC-specific innovation (confirm by synteny; rule out detection failure for short/divergent ORFs)

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callGA · growth-advantage
What the call meansgrowth-advantage: insertions enriched
TA sites (Himar1) 7 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 7 growth-advantage. Saturation 1.000, mean read count 337.857142857. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 7 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 7 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 8 of 16 independent MS datasets
Integrated abundance23.9 ppm · rank 2218/3519 (37.0th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length125 aa
Molecular weight14.4 kDa
Theoretical pI10.18
GRAVY-0.435 (hydrophilic)
Aliphatic index77.4
Aromaticity0.12
Instability index35.7 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Gp49PF05973.21 1.5e-1827–113 Phage derived protein Gp49-like (DUF891)

Experimental structures (Protein Data Bank) 2 solved

PDBMethodResolutionCoverage
7awk X-ray diffraction 1.91 Å 100%
7nbu Electron Microscopy 3.11 Å 95%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 78.7

PDB hitprobTM-scoreE-valueDescription
7awk-assembly1_A 1.00 0.93 3.9e-18 sig 7awk-assembly1_A Crystal structure of the HigB1 toxin mutant K95A from Mycobacterium tuberculosis (Rv1955)
3g5o-assembly1_C 0.99 0.57 7.6e-03 sig 3g5o-assembly1_C The crystal structure of the toxin-antitoxin complex RelBE2 (Rv2865-2866) from Mycobacterium tuberculosis

Foldseek search of the AlphaFold DB model (mean pLDDT 78.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)Rv1954c (- strand, -26 bp gap)
Downstream (3' on genome)higA (+ strand, 41 bp gap)
Predicted operon higB · higA · Rv1957

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: higA (antitoxin HigA), high confidence from genomic context alone (score 952 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1956 higA exp antitoxin HigA 993 952 ctx neighborhood:682 coexpression:731 experimental:484 textmining:880
Rv1957 secBL SecB-like chaperone 970 783 ctx neighborhood:695 textmining:870
Rv1954A Rv1954A, len: 100 aa. Hypothetical unknown protein. 618 513 ctx neighborhood:513
Rv1077 cbs exp cystathionine beta-synthase 547 511 experimental:484
Rv1843c guaB1 exp inosine-5'-monophosphate dehydrogenase 542 505 experimental:484
Rv2021c higA2 transcriptional regulator 684 78 textmining:672
Rv3183 higA3 transcriptional regulator 471 78 textmining:451
Rv1952 vapB14 antitoxin VapB14 591 76 textmining:576
Rv1954c hyp hypothetical protein 527 70 textmining:513
Rv3384c vapC46 ribonuclease VapC46 447 64 textmining:434
Rv1246c relE toxin RelE 838 56 textmining:836
Rv1102c mazF3 mRNA interferase MazF3 439 56 textmining:431
Rv2829c vapC22 ribonuclease VapC22 444 55 textmining:436
Rv2022c higB2 hyp hypothetical protein 809 52 textmining:807
Rv1991c mazF6 mRNA interferase MazF6 518 52 textmining:513

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: toxin HigB
  • MTBC0 PGAP product: type II toxin-antitoxin system toxin HigB
  • Pfam (hmmscan --cut_ga): Gp49 PF05973.21 (E=1e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216471.2)
  • Domains: Pfam-A via hmmscan --cut_ga — Gp49 (PF05973.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4679
  • Curated reference: UniProt P9WJA5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 78.7)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor higA
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002070|Rv1955|higB
MPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLFFRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI