higB Resolved · high auto-curated
H37Rv Rv1955 · MTBC0 mtbc0_002070 ·
125 aa ·
2220835–2221212 MTBC0
(+) ·
RefSeq NP_216471.2
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | toxin HigB |
|---|---|
| MTBC0 PGAP re-annotation | type II toxin-antitoxin system toxin HigB |
| Revised (this work) | Type II toxin-antitoxin system toxin HigB. Pfam: Gp49 (PF05973.21). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 9 publications
9 TB publications mention this gene. 9 publication(s) discuss this gene (10 in a M. tuberculosis context, 2 in other mycobacteria — M. marinum (1), M. smegmatis (1)).
| Publication | Date |
|---|---|
| A multi-omics investigation into the mechanisms of hyper-virulence in Mycobacterium tuberculosis. doi:10.1080/21505594.2022.2087304 | 2022 |
| HigB1 Toxin in Mycobacterium tuberculosis Is Upregulated During Stress and Required to Establish Infection in Guinea Pigs. doi:10.3389/fmicb.2021.748890 | 2021 |
| Induced DNA bending by unique dimerization of HigA antitoxin. doi:10.1107/S2052252520006466 | 2020 |
| Directed evolution of SecB chaperones toward toxin-antitoxin systems. doi:10.1073/pnas.1710456114 | 2017 |
| [Polymorphisms of toxin-antitoxin-chaperone system of Mycobacterium tuberculosis complex in China]. doi:10.3760/cma.j.issn.0254-6450.2016.03.021 | 2016 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) antiparallel · 7 % of gene
| Neighbour | Rv1954c (Rv1954c, - strand) |
|---|---|
| Overlap | 26 bp, 7 % of this gene's length |
antiparallel overlap: this gene may inherit essentiality/conservation signal from its neighbour through shared TA sites or promoter constraint, without any protein of its own being produced (cf. Rv2438A/nadE) Signals attributed to this gene (Tn-seq essentiality via shared TA sites, conservation via promoter constraint) should be cross-checked against the neighbour before being read as its own. P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 1.69 (95% CI -0.18 to 5.02). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1990
· 100.0% identity |
|---|---|
| M. orygis |
RJtmp_002029
· 99.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WJA5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable endoribonuclease HigB1 |
| EC (curated) |
EC 3.1.-.-
|
| Curated function | Toxic component of an atypical, type II toxin-antitoxin chaperone (TAC) system. Upon expression in M.smegmatis inhibits colony formation and cell growth. Ectopic expression in wild-type M.tuberculosis has no effect on cell growth; ectopic expression in a triple higB1-higA1-Rv1957 (delta TAC) disruption mutant causes growth arrest, killing a considerable proportion of the cells. Increased ectopic expression leads to decreased levels of IdeR- and Zur-regulated genes as well as cleavage within the mRNA region of tmRNA (transfer-mRNA), strongly suggesting it is an endoribonuclease; also degrades E. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Phage derived protein Gp49-like (DUF891) |
| Orthologous group | COG4679 |
| Gene Ontology (40) |
GO:0001666, GO:0003674, GO:0003824, GO:0004518, GO:0004519, GO:0004521, GO:0004540, GO:0006139, GO:0006725, GO:0006807, GO:0006950, GO:0008150 +28 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) MTBC-specific
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 0/53 (0%)
· 0/4 closest MTBAP relatives absent from ALL 53 non-MTBC Mycobacterium genomes tested (incl. the closest MTBAP relatives) — a candidate MTBC-specific genetic innovation / host-adaptation factor (confirm by synteny; rule out a short/low-complexity ORF and extreme divergence) |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria absent from the whole genus and from all outgroups tested — a candidate MTBC-specific innovation (confirm by synteny; rule out detection failure for short/divergent ORFs) |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | GA · growth-advantage |
|---|---|
| What the call means | growth-advantage: insertions enriched |
| TA sites (Himar1) | 7 in the ORF — 0 in the essential state, 0 growth-defect, 0 non-essential, 7 growth-advantage. Saturation 1.000, mean read count 337.857142857. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 7 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 7 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 8 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 23.9 ppm · rank 2218/3519 (37.0th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 125 aa |
|---|---|
| Molecular weight | 14.4 kDa |
| Theoretical pI | 10.18 |
| GRAVY | -0.435 (hydrophilic) |
| Aliphatic index | 77.4 |
| Aromaticity | 0.12 |
| Instability index | 35.7 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Gp49 | PF05973.21 | 1.5e-18 | 27–113 | Phage derived protein Gp49-like (DUF891) |
Experimental structures (Protein Data Bank) 2 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
7awk |
X-ray diffraction | 1.91 Å | 100% |
7nbu |
Electron Microscopy | 3.11 Å | 95% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 78.7
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7awk-assembly1_A |
1.00 | 0.93 | 3.9e-18 sig | 7awk-assembly1_A Crystal structure of the HigB1 toxin mutant K95A from Mycobacterium tuberculosis (Rv1955) |
3g5o-assembly1_C |
0.99 | 0.57 | 7.6e-03 sig | 3g5o-assembly1_C The crystal structure of the toxin-antitoxin complex RelBE2 (Rv2865-2866) from Mycobacterium tuberculosis |
Foldseek search of the AlphaFold DB model (mean pLDDT 78.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv1954c (- strand, -26 bp gap) |
|---|---|
| Downstream (3' on genome) | higA (+ strand, 41 bp gap) |
| Predicted operon |
higB · higA · Rv1957
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: higA (antitoxin HigA), high confidence from genomic context alone (score 952 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1956 higA exp |
antitoxin HigA | 993 | 952 ctx | neighborhood:682 coexpression:731 experimental:484 textmining:880 |
Rv1957 secBL |
SecB-like chaperone | 970 | 783 ctx | neighborhood:695 textmining:870 |
Rv1954A |
Rv1954A, len: 100 aa. Hypothetical unknown protein. | 618 | 513 ctx | neighborhood:513 |
Rv1077 cbs exp |
cystathionine beta-synthase | 547 | 511 | experimental:484 |
Rv1843c guaB1 exp |
inosine-5'-monophosphate dehydrogenase | 542 | 505 | experimental:484 |
Rv2021c higA2 |
transcriptional regulator | 684 | 78 | textmining:672 |
Rv3183 higA3 |
transcriptional regulator | 471 | 78 | textmining:451 |
Rv1952 vapB14 |
antitoxin VapB14 | 591 | 76 | textmining:576 |
Rv1954c hyp |
hypothetical protein | 527 | 70 | textmining:513 |
Rv3384c vapC46 |
ribonuclease VapC46 | 447 | 64 | textmining:434 |
Rv1246c relE |
toxin RelE | 838 | 56 | textmining:836 |
Rv1102c mazF3 |
mRNA interferase MazF3 | 439 | 56 | textmining:431 |
Rv2829c vapC22 |
ribonuclease VapC22 | 444 | 55 | textmining:436 |
Rv2022c higB2 hyp |
hypothetical protein | 809 | 52 | textmining:807 |
Rv1991c mazF6 |
mRNA interferase MazF6 | 518 | 52 | textmining:513 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: toxin HigB
- MTBC0 PGAP product: type II toxin-antitoxin system toxin HigB
- Pfam (hmmscan --cut_ga): Gp49 PF05973.21 (E=1e-18)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216471.2)
- Domains: Pfam-A via hmmscan --cut_ga — Gp49 (PF05973.21)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4679 - Curated reference: UniProt P9WJA5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 78.7)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
19 functional partner(s); context anchor
higA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002070|Rv1955|higB MPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLFFRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for higB? Email the maintainer — the message is pre-filled with this gene's details.